Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V6U63_RS09275 Genome accession   NZ_CP145861
Coordinates   1997769..1997999 (-) Length   76 a.a.
NCBI ID   WP_021144685.1    Uniprot ID   -
Organism   Streptococcus salivarius strain KSS3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1992769..2002999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U63_RS09240 (V6U63_09225) - 1993159..1993605 (-) 447 WP_021144682.1 hypothetical protein -
  V6U63_RS09245 (V6U63_09230) - 1993683..1994339 (-) 657 WP_410535064.1 CPBP family intramembrane glutamic endopeptidase -
  V6U63_RS09250 (V6U63_09235) - 1994351..1994548 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  V6U63_RS09255 (V6U63_09240) - 1994799..1995992 (-) 1194 WP_410535066.1 acetate kinase -
  V6U63_RS09260 (V6U63_09245) comGH 1996049..1997005 (-) 957 WP_227071975.1 class I SAM-dependent methyltransferase Machinery gene
  V6U63_RS09265 (V6U63_09250) comGG 1997050..1997367 (-) 318 WP_227071976.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6U63_RS09270 (V6U63_09255) comGF 1997345..1997782 (-) 438 WP_227071977.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6U63_RS09275 (V6U63_09260) comGE 1997769..1997999 (-) 231 WP_021144685.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6U63_RS09280 (V6U63_09265) comGD 1998031..1998459 (-) 429 WP_253183813.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6U63_RS09285 (V6U63_09270) comGC 1998419..1998745 (-) 327 WP_002885815.1 competence type IV pilus major pilin ComGC Machinery gene
  V6U63_RS09290 (V6U63_09275) comGB 1998742..1999842 (-) 1101 WP_144429890.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6U63_RS09295 (V6U63_09280) comGA 1999724..2000665 (-) 942 WP_002885658.1 competence type IV pilus ATPase ComGA Machinery gene
  V6U63_RS09300 (V6U63_09285) - 2000747..2001109 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8413.85 Da        Isoelectric Point: 10.4655

>NTDB_id=853322 V6U63_RS09275 WP_021144685.1 1997769..1997999(-) (comGE) [Streptococcus salivarius strain KSS3]
MAVLVLVSGLILEQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=853322 V6U63_RS09275 WP_021144685.1 1997769..1997999(-) (comGE) [Streptococcus salivarius strain KSS3]
ATGGCTGTTTTAGTACTTGTCAGTGGTCTTATTTTGGAACAAATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACAAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTTAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368