Detailed information NTG0852927

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QYE82_RS06125
• Genome accession: NZ_CP129374
• Coordinates: 1270974..1271291 (+)
• Length: 105 a.a.
• NCBI ID: WP_002446532.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain CSMH-411EB
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1265974..1276291

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QYE82_RS06095	-	1266751..1266951 (+)	201	WP_002446537.1	YqgQ family protein	-
QYE82_RS06100	-	1266951..1267937 (+)	987	WP_020362277.1	ROK family glucokinase	-
QYE82_RS06105	-	1267937..1268263 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
QYE82_RS06110	-	1268263..1268886 (+)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
QYE82_RS06115	comGA	1268943..1269917 (+)	975	WP_301560328.1	competence type IV pilus ATPase ComGA	Machinery gene
QYE82_RS06120	comGB	1269889..1270956 (+)	1068	WP_002496884.1	competence type IV pilus assembly protein ComGB	Machinery gene
QYE82_RS06125	comGC	1270974..1271291 (+)	318	WP_002446532.1	competence type IV pilus major pilin ComGC	Machinery gene
QYE82_RS06130	comGD	1271281..1271718 (+)	438	WP_301560329.1	competence type IV pilus minor pilin ComGD	-
QYE82_RS06135	-	1271705..1271998 (+)	294	WP_020367648.1	hypothetical protein	-
QYE82_RS06140	comGF	1271922..1272413 (+)	492	WP_301560330.1	competence type IV pilus minor pilin ComGF	-
QYE82_RS06145	-	1272578..1273090 (+)	513	WP_002496881.1	shikimate kinase	-
QYE82_RS06150	gcvT	1273308..1274399 (+)	1092	WP_002501008.1	glycine cleavage system aminomethyltransferase GcvT	-
QYE82_RS06155	gcvPA	1274419..1275765 (+)	1347	WP_002497331.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.53 Da
• Isoelectric Point: 9.2160

>NTDB_id=852927 QYE82_RS06125 WP_002446532.1 1270974..1271291(+) (comGC) [Staphylococcus epidermidis strain CSMH-411EB]
MKTLKLLKQTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=852927 QYE82_RS06125 WP_002446532.1 1270974..1271291(+) (comGC) [Staphylococcus epidermidis strain CSMH-411EB]
ATGAAAACATTGAAATTATTGAAACAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATCAGTTT
ATTATTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAACCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATAAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comGC/cglC	Streptococcus mitis SK321	43.689	98.095	0.429
comGC/cglC	Streptococcus pneumoniae R6	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae D39	43.617	89.524	0.39
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	50	72.381	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362