Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | QYH60_RS03815 | Genome accession | NZ_CP129292 |
| Coordinates | 744007..744363 (+) | Length | 118 a.a. |
| NCBI ID | WP_301401359.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain KMGR2-43 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 708632..755579 | 744007..744363 | within | 0 |
Gene organization within MGE regions
Location: 708632..755579
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QYH60_RS03555 (QYH60_03555) | comGB | 708647..709720 (+) | 1074 | WP_081042697.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| QYH60_RS03560 (QYH60_03560) | - | 709734..709874 (+) | 141 | WP_023164653.1 | hypothetical protein | - |
| QYH60_RS03565 (QYH60_03565) | - | 709871..711328 (-) | 1458 | WP_301401299.1 | recombinase family protein | - |
| QYH60_RS03570 (QYH60_03570) | - | 711447..711986 (-) | 540 | WP_023164651.1 | PH domain-containing protein | - |
| QYH60_RS03575 (QYH60_03575) | - | 712042..712626 (-) | 585 | WP_301401301.1 | hypothetical protein | - |
| QYH60_RS03580 (QYH60_03580) | - | 712637..713059 (-) | 423 | WP_259752677.1 | XRE family transcriptional regulator | - |
| QYH60_RS03585 (QYH60_03585) | - | 713252..713461 (+) | 210 | WP_023349177.1 | helix-turn-helix transcriptional regulator | - |
| QYH60_RS03590 (QYH60_03590) | - | 713516..714229 (+) | 714 | WP_301401303.1 | ORF6C domain-containing protein | - |
| QYH60_RS03595 (QYH60_03595) | - | 714245..714427 (+) | 183 | WP_003130605.1 | hypothetical protein | - |
| QYH60_RS03600 (QYH60_03600) | - | 714424..714546 (+) | 123 | WP_023164646.1 | hypothetical protein | - |
| QYH60_RS03605 (QYH60_03605) | - | 714559..714744 (+) | 186 | WP_167593672.1 | hypothetical protein | - |
| QYH60_RS03610 (QYH60_03610) | - | 714775..714948 (+) | 174 | WP_301401305.1 | putative transcriptional regulator | - |
| QYH60_RS03615 (QYH60_03615) | - | 714982..715920 (+) | 939 | WP_301401307.1 | recombinase RecT | - |
| QYH60_RS03620 (QYH60_03620) | - | 715922..716989 (+) | 1068 | WP_301401309.1 | DUF1351 domain-containing protein | - |
| QYH60_RS03625 (QYH60_03625) | - | 717252..718178 (+) | 927 | WP_301401311.1 | phage replisome organizer N-terminal domain-containing protein | - |
| QYH60_RS03630 (QYH60_03630) | - | 718171..718413 (+) | 243 | WP_259749452.1 | L-rhamnose isomerase | - |
| QYH60_RS03635 (QYH60_03635) | - | 718426..718842 (+) | 417 | WP_046782281.1 | hypothetical protein | - |
| QYH60_RS03640 (QYH60_03640) | - | 719159..719434 (+) | 276 | WP_143458092.1 | hypothetical protein | - |
| QYH60_RS03645 (QYH60_03645) | - | 719431..720105 (+) | 675 | WP_301401313.1 | DUF1642 domain-containing protein | - |
| QYH60_RS03650 (QYH60_03650) | - | 720102..720341 (+) | 240 | WP_301401315.1 | hypothetical protein | - |
| QYH60_RS03655 (QYH60_03655) | dut | 720338..720760 (+) | 423 | WP_301401317.1 | dUTP diphosphatase | - |
| QYH60_RS03660 (QYH60_03660) | - | 720765..721187 (+) | 423 | WP_301401319.1 | hypothetical protein | - |
| QYH60_RS03665 (QYH60_03665) | - | 721180..721344 (+) | 165 | WP_010905361.1 | hypothetical protein | - |
| QYH60_RS03670 (QYH60_03670) | - | 721391..721621 (+) | 231 | WP_058213312.1 | hypothetical protein | - |
| QYH60_RS03675 (QYH60_03675) | - | 721618..721839 (+) | 222 | WP_301401322.1 | DUF1660 domain-containing protein | - |
| QYH60_RS03680 (QYH60_03680) | - | 721829..722317 (+) | 489 | WP_301401323.1 | hypothetical protein | - |
| QYH60_RS03685 (QYH60_03685) | - | 722615..723004 (+) | 390 | WP_301401325.1 | DUF722 domain-containing protein | - |
| QYH60_RS03690 (QYH60_03690) | - | 723437..723646 (+) | 210 | Protein_685 | HNH endonuclease | - |
| QYH60_RS03695 (QYH60_03695) | - | 723764..723985 (+) | 222 | Protein_686 | helix-turn-helix domain-containing protein | - |
| QYH60_RS03700 (QYH60_03700) | terL | 723966..725417 (+) | 1452 | WP_194942657.1 | phage terminase large subunit | - |
| QYH60_RS03705 (QYH60_03705) | - | 725430..726959 (+) | 1530 | WP_259763053.1 | phage portal protein | - |
| QYH60_RS03710 (QYH60_03710) | - | 726952..727782 (+) | 831 | WP_301401327.1 | phage minor head protein | - |
| QYH60_RS03715 (QYH60_03715) | - | 727798..728847 (+) | 1050 | WP_301401329.1 | XkdF-like putative serine protease domain-containing protein | - |
| QYH60_RS03720 (QYH60_03720) | - | 728862..729779 (+) | 918 | WP_301401331.1 | phage capsid protein | - |
| QYH60_RS03725 (QYH60_03725) | - | 729808..730041 (+) | 234 | WP_301401333.1 | Ig-like domain-containing protein | - |
| QYH60_RS03730 (QYH60_03730) | - | 730098..730499 (+) | 402 | WP_301401335.1 | hypothetical protein | - |
| QYH60_RS03735 (QYH60_03735) | - | 730489..730833 (+) | 345 | WP_301401337.1 | putative minor capsid protein | - |
| QYH60_RS03740 (QYH60_03740) | - | 730830..731159 (+) | 330 | WP_003131320.1 | hypothetical protein | - |
| QYH60_RS03745 (QYH60_03745) | - | 731159..731593 (+) | 435 | WP_143459400.1 | minor capsid protein | - |
| QYH60_RS03750 (QYH60_03750) | - | 731607..732086 (+) | 480 | WP_167593748.1 | hypothetical protein | - |
| QYH60_RS03755 (QYH60_03755) | - | 732143..732550 (+) | 408 | WP_301401339.1 | hypothetical protein | - |
| QYH60_RS03760 (QYH60_03760) | - | 732566..733273 (+) | 708 | WP_301401341.1 | Gp15 family bacteriophage protein | - |
| QYH60_RS03765 (QYH60_03765) | - | 733263..735821 (+) | 2559 | WP_301401343.1 | phage tail tape measure protein | - |
| QYH60_RS03770 (QYH60_03770) | - | 735821..736546 (+) | 726 | WP_301401345.1 | phage tail protein | - |
| QYH60_RS03775 (QYH60_03775) | - | 736543..740760 (+) | 4218 | WP_301401347.1 | phage tail spike protein | - |
| QYH60_RS03780 (QYH60_03780) | - | 740747..741160 (+) | 414 | WP_301401349.1 | DUF1617 family protein | - |
| QYH60_RS03785 (QYH60_03785) | - | 741162..741389 (+) | 228 | WP_301401351.1 | hypothetical protein | - |
| QYH60_RS03790 (QYH60_03790) | - | 741414..741638 (+) | 225 | WP_010905920.1 | hemolysin XhlA family protein | - |
| QYH60_RS03795 (QYH60_03795) | - | 741652..741939 (+) | 288 | WP_301401353.1 | phage holin | - |
| QYH60_RS03800 (QYH60_03800) | - | 741939..742718 (+) | 780 | WP_301401355.1 | peptidoglycan amidohydrolase family protein | - |
| QYH60_RS03805 (QYH60_03805) | - | 742796..743515 (+) | 720 | WP_301401357.1 | hypothetical protein | - |
| QYH60_RS03810 (QYH60_03810) | comGC | 743676..743972 (+) | 297 | WP_167593410.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QYH60_RS03815 (QYH60_03815) | comGD | 744007..744363 (+) | 357 | WP_301401359.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| QYH60_RS03820 (QYH60_03820) | comGE | 744335..744631 (+) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| QYH60_RS03825 (QYH60_03825) | comGF | 744594..745040 (+) | 447 | WP_029344525.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| QYH60_RS03830 (QYH60_03830) | comGG | 745079..745363 (+) | 285 | WP_025017139.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QYH60_RS03835 (QYH60_03835) | - | 745445..745882 (+) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| QYH60_RS03840 (QYH60_03840) | - | 745879..746721 (+) | 843 | WP_015427160.1 | metal ABC transporter substrate-binding protein | - |
| QYH60_RS03845 (QYH60_03845) | - | 746898..747635 (+) | 738 | WP_012898617.1 | metal ABC transporter ATP-binding protein | - |
| QYH60_RS03850 (QYH60_03850) | - | 747628..748437 (+) | 810 | WP_014570791.1 | metal ABC transporter permease | - |
| QYH60_RS03855 (QYH60_03855) | - | 748475..749341 (-) | 867 | WP_025017140.1 | RluA family pseudouridine synthase | - |
| QYH60_RS03860 (QYH60_03860) | - | 749546..749923 (+) | 378 | WP_003129983.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| QYH60_RS03865 (QYH60_03865) | - | 750037..750468 (+) | 432 | WP_010906308.1 | DUF3290 domain-containing protein | - |
| QYH60_RS03870 (QYH60_03870) | - | 750485..751120 (+) | 636 | WP_058207954.1 | DUF421 domain-containing protein | - |
| QYH60_RS03875 (QYH60_03875) | - | 751429..753660 (+) | 2232 | WP_301401361.1 | PBP1A family penicillin-binding protein | - |
| QYH60_RS03880 (QYH60_03880) | - | 753762..755579 (+) | 1818 | WP_039116455.1 | acyltransferase family protein | - |
Sequence
Protein
Download Length: 118 a.a. Molecular weight: 13614.82 Da Isoelectric Point: 7.9853
>NTDB_id=852082 QYH60_RS03815 WP_301401359.1 744007..744363(+) (comGD) [Lactococcus lactis subsp. lactis strain KMGR2-43]
MIISFITTLFPSEIIQTVHLFKGELFVLQFENFYKRSQEEAALLQKSESLVAKNQELICEDRSITIPKEVAVKDFTVKFD
DKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS
MIISFITTLFPSEIIQTVHLFKGELFVLQFENFYKRSQEEAALLQKSESLVAKNQELICEDRSITIPKEVAVKDFTVKFD
DKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS
Nucleotide
Download Length: 357 bp
>NTDB_id=852082 QYH60_RS03815 WP_301401359.1 744007..744363(+) (comGD) [Lactococcus lactis subsp. lactis strain KMGR2-43]
TTGATTATTTCTTTTATCACAACTCTTTTTCCTTCAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTTTGT
TCTTCAATTTGAAAATTTCTATAAAAGGAGTCAAGAAGAGGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAA
ATCAAGAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGAT
GATAAGGGAGAGAATTCTAGCTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGA
GATAGGCAGTGGAAAATTTAAAAAGAAAATCAGTTAA
TTGATTATTTCTTTTATCACAACTCTTTTTCCTTCAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTTTGT
TCTTCAATTTGAAAATTTCTATAAAAGGAGTCAAGAAGAGGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAA
ATCAAGAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGAT
GATAAGGGAGAGAATTCTAGCTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGA
GATAGGCAGTGGAAAATTTAAAAAGAAAATCAGTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
64.957 |
99.153 |
0.644 |