Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QYH60_RS03815 Genome accession   NZ_CP129292
Coordinates   744007..744363 (+) Length   118 a.a.
NCBI ID   WP_301401359.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain KMGR2-43     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 708632..755579 744007..744363 within 0


Gene organization within MGE regions


Location: 708632..755579
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYH60_RS03555 (QYH60_03555) comGB 708647..709720 (+) 1074 WP_081042697.1 competence type IV pilus assembly protein ComGB Machinery gene
  QYH60_RS03560 (QYH60_03560) - 709734..709874 (+) 141 WP_023164653.1 hypothetical protein -
  QYH60_RS03565 (QYH60_03565) - 709871..711328 (-) 1458 WP_301401299.1 recombinase family protein -
  QYH60_RS03570 (QYH60_03570) - 711447..711986 (-) 540 WP_023164651.1 PH domain-containing protein -
  QYH60_RS03575 (QYH60_03575) - 712042..712626 (-) 585 WP_301401301.1 hypothetical protein -
  QYH60_RS03580 (QYH60_03580) - 712637..713059 (-) 423 WP_259752677.1 XRE family transcriptional regulator -
  QYH60_RS03585 (QYH60_03585) - 713252..713461 (+) 210 WP_023349177.1 helix-turn-helix transcriptional regulator -
  QYH60_RS03590 (QYH60_03590) - 713516..714229 (+) 714 WP_301401303.1 ORF6C domain-containing protein -
  QYH60_RS03595 (QYH60_03595) - 714245..714427 (+) 183 WP_003130605.1 hypothetical protein -
  QYH60_RS03600 (QYH60_03600) - 714424..714546 (+) 123 WP_023164646.1 hypothetical protein -
  QYH60_RS03605 (QYH60_03605) - 714559..714744 (+) 186 WP_167593672.1 hypothetical protein -
  QYH60_RS03610 (QYH60_03610) - 714775..714948 (+) 174 WP_301401305.1 putative transcriptional regulator -
  QYH60_RS03615 (QYH60_03615) - 714982..715920 (+) 939 WP_301401307.1 recombinase RecT -
  QYH60_RS03620 (QYH60_03620) - 715922..716989 (+) 1068 WP_301401309.1 DUF1351 domain-containing protein -
  QYH60_RS03625 (QYH60_03625) - 717252..718178 (+) 927 WP_301401311.1 phage replisome organizer N-terminal domain-containing protein -
  QYH60_RS03630 (QYH60_03630) - 718171..718413 (+) 243 WP_259749452.1 L-rhamnose isomerase -
  QYH60_RS03635 (QYH60_03635) - 718426..718842 (+) 417 WP_046782281.1 hypothetical protein -
  QYH60_RS03640 (QYH60_03640) - 719159..719434 (+) 276 WP_143458092.1 hypothetical protein -
  QYH60_RS03645 (QYH60_03645) - 719431..720105 (+) 675 WP_301401313.1 DUF1642 domain-containing protein -
  QYH60_RS03650 (QYH60_03650) - 720102..720341 (+) 240 WP_301401315.1 hypothetical protein -
  QYH60_RS03655 (QYH60_03655) dut 720338..720760 (+) 423 WP_301401317.1 dUTP diphosphatase -
  QYH60_RS03660 (QYH60_03660) - 720765..721187 (+) 423 WP_301401319.1 hypothetical protein -
  QYH60_RS03665 (QYH60_03665) - 721180..721344 (+) 165 WP_010905361.1 hypothetical protein -
  QYH60_RS03670 (QYH60_03670) - 721391..721621 (+) 231 WP_058213312.1 hypothetical protein -
  QYH60_RS03675 (QYH60_03675) - 721618..721839 (+) 222 WP_301401322.1 DUF1660 domain-containing protein -
  QYH60_RS03680 (QYH60_03680) - 721829..722317 (+) 489 WP_301401323.1 hypothetical protein -
  QYH60_RS03685 (QYH60_03685) - 722615..723004 (+) 390 WP_301401325.1 DUF722 domain-containing protein -
  QYH60_RS03690 (QYH60_03690) - 723437..723646 (+) 210 Protein_685 HNH endonuclease -
  QYH60_RS03695 (QYH60_03695) - 723764..723985 (+) 222 Protein_686 helix-turn-helix domain-containing protein -
  QYH60_RS03700 (QYH60_03700) terL 723966..725417 (+) 1452 WP_194942657.1 phage terminase large subunit -
  QYH60_RS03705 (QYH60_03705) - 725430..726959 (+) 1530 WP_259763053.1 phage portal protein -
  QYH60_RS03710 (QYH60_03710) - 726952..727782 (+) 831 WP_301401327.1 phage minor head protein -
  QYH60_RS03715 (QYH60_03715) - 727798..728847 (+) 1050 WP_301401329.1 XkdF-like putative serine protease domain-containing protein -
  QYH60_RS03720 (QYH60_03720) - 728862..729779 (+) 918 WP_301401331.1 phage capsid protein -
  QYH60_RS03725 (QYH60_03725) - 729808..730041 (+) 234 WP_301401333.1 Ig-like domain-containing protein -
  QYH60_RS03730 (QYH60_03730) - 730098..730499 (+) 402 WP_301401335.1 hypothetical protein -
  QYH60_RS03735 (QYH60_03735) - 730489..730833 (+) 345 WP_301401337.1 putative minor capsid protein -
  QYH60_RS03740 (QYH60_03740) - 730830..731159 (+) 330 WP_003131320.1 hypothetical protein -
  QYH60_RS03745 (QYH60_03745) - 731159..731593 (+) 435 WP_143459400.1 minor capsid protein -
  QYH60_RS03750 (QYH60_03750) - 731607..732086 (+) 480 WP_167593748.1 hypothetical protein -
  QYH60_RS03755 (QYH60_03755) - 732143..732550 (+) 408 WP_301401339.1 hypothetical protein -
  QYH60_RS03760 (QYH60_03760) - 732566..733273 (+) 708 WP_301401341.1 Gp15 family bacteriophage protein -
  QYH60_RS03765 (QYH60_03765) - 733263..735821 (+) 2559 WP_301401343.1 phage tail tape measure protein -
  QYH60_RS03770 (QYH60_03770) - 735821..736546 (+) 726 WP_301401345.1 phage tail protein -
  QYH60_RS03775 (QYH60_03775) - 736543..740760 (+) 4218 WP_301401347.1 phage tail spike protein -
  QYH60_RS03780 (QYH60_03780) - 740747..741160 (+) 414 WP_301401349.1 DUF1617 family protein -
  QYH60_RS03785 (QYH60_03785) - 741162..741389 (+) 228 WP_301401351.1 hypothetical protein -
  QYH60_RS03790 (QYH60_03790) - 741414..741638 (+) 225 WP_010905920.1 hemolysin XhlA family protein -
  QYH60_RS03795 (QYH60_03795) - 741652..741939 (+) 288 WP_301401353.1 phage holin -
  QYH60_RS03800 (QYH60_03800) - 741939..742718 (+) 780 WP_301401355.1 peptidoglycan amidohydrolase family protein -
  QYH60_RS03805 (QYH60_03805) - 742796..743515 (+) 720 WP_301401357.1 hypothetical protein -
  QYH60_RS03810 (QYH60_03810) comGC 743676..743972 (+) 297 WP_167593410.1 competence type IV pilus major pilin ComGC Machinery gene
  QYH60_RS03815 (QYH60_03815) comGD 744007..744363 (+) 357 WP_301401359.1 competence type IV pilus minor pilin ComGD Machinery gene
  QYH60_RS03820 (QYH60_03820) comGE 744335..744631 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  QYH60_RS03825 (QYH60_03825) comGF 744594..745040 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  QYH60_RS03830 (QYH60_03830) comGG 745079..745363 (+) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  QYH60_RS03835 (QYH60_03835) - 745445..745882 (+) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  QYH60_RS03840 (QYH60_03840) - 745879..746721 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  QYH60_RS03845 (QYH60_03845) - 746898..747635 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  QYH60_RS03850 (QYH60_03850) - 747628..748437 (+) 810 WP_014570791.1 metal ABC transporter permease -
  QYH60_RS03855 (QYH60_03855) - 748475..749341 (-) 867 WP_025017140.1 RluA family pseudouridine synthase -
  QYH60_RS03860 (QYH60_03860) - 749546..749923 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  QYH60_RS03865 (QYH60_03865) - 750037..750468 (+) 432 WP_010906308.1 DUF3290 domain-containing protein -
  QYH60_RS03870 (QYH60_03870) - 750485..751120 (+) 636 WP_058207954.1 DUF421 domain-containing protein -
  QYH60_RS03875 (QYH60_03875) - 751429..753660 (+) 2232 WP_301401361.1 PBP1A family penicillin-binding protein -
  QYH60_RS03880 (QYH60_03880) - 753762..755579 (+) 1818 WP_039116455.1 acyltransferase family protein -

Sequence


Protein


Download         Length: 118 a.a.        Molecular weight: 13614.82 Da        Isoelectric Point: 7.9853

>NTDB_id=852082 QYH60_RS03815 WP_301401359.1 744007..744363(+) (comGD) [Lactococcus lactis subsp. lactis strain KMGR2-43]
MIISFITTLFPSEIIQTVHLFKGELFVLQFENFYKRSQEEAALLQKSESLVAKNQELICEDRSITIPKEVAVKDFTVKFD
DKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 357 bp        

>NTDB_id=852082 QYH60_RS03815 WP_301401359.1 744007..744363(+) (comGD) [Lactococcus lactis subsp. lactis strain KMGR2-43]
TTGATTATTTCTTTTATCACAACTCTTTTTCCTTCAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTTTGT
TCTTCAATTTGAAAATTTCTATAAAAGGAGTCAAGAAGAGGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAA
ATCAAGAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGAT
GATAAGGGAGAGAATTCTAGCTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGA
GATAGGCAGTGGAAAATTTAAAAAGAAAATCAGTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

64.957

99.153

0.644