Detailed information NTG0848168

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: V5G23_RS16400
• Genome accession: NZ_CP144925
• Coordinates: 3181365..3181802 (+)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain CP13
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3176365..3186802

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V5G23_RS16365 (V5G23_16365)	-	3176895..3177140 (-)	246	WP_003183483.1	DUF2626 domain-containing protein	-
V5G23_RS16370 (V5G23_16370)	-	3177349..3177726 (+)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
V5G23_RS16380 (V5G23_16380)	-	3177968..3178807 (+)	840	WP_003183480.1	STAS domain-containing protein	-
V5G23_RS16385 (V5G23_16385)	comGA	3178964..3180028 (+)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
V5G23_RS16390 (V5G23_16390)	comGB	3180018..3181052 (+)	1035	WP_075218359.1	competence type IV pilus assembly protein ComGB	Machinery gene
V5G23_RS16395 (V5G23_16395)	comGC	3181066..3181359 (+)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
V5G23_RS16400 (V5G23_16400)	comGD	3181365..3181802 (+)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
V5G23_RS16405 (V5G23_16405)	comGE	3181786..3182133 (+)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
V5G23_RS16410 (V5G23_16410)	comGF	3182159..3182530 (+)	372	WP_003183461.1	competence type IV pilus minor pilin ComGF	Machinery gene
V5G23_RS16415 (V5G23_16415)	comGG	3182543..3182908 (+)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
V5G23_RS16420 (V5G23_16420)	-	3182997..3183179 (+)	183	WP_003183456.1	YqzE family protein	-
V5G23_RS16425 (V5G23_16425)	-	3183203..3183490 (-)	288	WP_223307118.1	YqzG/YhdC family protein	-
V5G23_RS16430 (V5G23_16430)	tapA	3183800..3184528 (+)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
V5G23_RS16435 (V5G23_16435)	-	3184525..3185109 (+)	585	WP_003183449.1	signal peptidase I	-
V5G23_RS16440 (V5G23_16440)	-	3185183..3185977 (+)	795	WP_003183447.1	TasA family protein	-
V5G23_RS16445 (V5G23_16445)	sinR	3186082..3186417 (-)	336	WP_025804940.1	helix-turn-helix domain-containing protein	Regulator
V5G23_RS16450 (V5G23_16450)	sinI	3186451..3186627 (-)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=848168 V5G23_RS16400 WP_009327905.1 3181365..3181802(+) (comGD) [Bacillus licheniformis strain CP13]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=848168 V5G23_RS16400 WP_009327905.1 3181365..3181802(+) (comGD) [Bacillus licheniformis strain CP13]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393