Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QTN45_RS07810 Genome accession   NZ_CP128500
Coordinates   1493116..1493289 (-) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain SRCM123364     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1488116..1498289
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN45_RS07760 (QTN45_07760) comGD 1488238..1488675 (+) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN45_RS07765 (QTN45_07765) comGE 1488659..1488973 (+) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN45_RS07770 (QTN45_07770) comGF 1488978..1489382 (+) 405 WP_289413132.1 competence type IV pilus minor pilin ComGF -
  QTN45_RS07775 (QTN45_07775) comGG 1489384..1489761 (+) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN45_RS07780 (QTN45_07780) - 1489815..1489994 (+) 180 WP_013352866.1 YqzE family protein -
  QTN45_RS07785 (QTN45_07785) - 1490035..1490364 (-) 330 WP_013352865.1 DUF3889 domain-containing protein -
  QTN45_RS07790 (QTN45_07790) tapA 1490622..1491293 (+) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  QTN45_RS07795 (QTN45_07795) sipW 1491265..1491849 (+) 585 WP_013352863.1 signal peptidase I SipW -
  QTN45_RS07800 (QTN45_07800) tasA 1491914..1492699 (+) 786 WP_013352862.1 biofilm matrix protein TasA -
  QTN45_RS07805 (QTN45_07805) sinR 1492747..1493082 (-) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  QTN45_RS07810 (QTN45_07810) sinI 1493116..1493289 (-) 174 WP_013352860.1 anti-repressor SinI Regulator
  QTN45_RS07815 (QTN45_07815) - 1493469..1494263 (-) 795 WP_013352859.1 YqhG family protein -
  QTN45_RS07820 (QTN45_07820) - 1494284..1495954 (-) 1671 WP_014470658.1 SNF2-related protein -
  QTN45_RS07825 (QTN45_07825) gcvT 1496378..1497478 (+) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=847774 QTN45_RS07810 WP_013352860.1 1493116..1493289(-) (sinI) [Bacillus amyloliquefaciens strain SRCM123364]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=847774 QTN45_RS07810 WP_013352860.1 1493116..1493289(-) (sinI) [Bacillus amyloliquefaciens strain SRCM123364]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684