Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLA22_RS10560 | Genome accession | NZ_CP128421 |
| Coordinates | 2073695..2073883 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain A.2.2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2068695..2078883
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLA22_RS10525 (LLA22_10580) | - | 2069621..2070430 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLA22_RS10530 (LLA22_10585) | - | 2070423..2071160 (-) | 738 | WP_015082929.1 | metal ABC transporter ATP-binding protein | - |
| LLA22_RS10535 (LLA22_10590) | - | 2071339..2072181 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLA22_RS10540 (LLA22_10595) | - | 2072178..2072615 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLA22_RS10545 (LLA22_10600) | comGG | 2072695..2072994 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLA22_RS10550 (LLA22_10605) | comGF | 2073018..2073443 (-) | 426 | WP_373467301.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLA22_RS10555 (LLA22_10610) | comGE | 2073427..2073663 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLA22_RS10560 (LLA22_10615) | comGD | 2073695..2073883 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLA22_RS10565 (LLA22_10620) | comGC | 2074085..2074435 (-) | 351 | WP_051013201.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLA22_RS10570 (LLA22_10625) | comGB | 2074480..2075505 (-) | 1026 | WP_051013189.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLA22_RS10575 (LLA22_10630) | comGA | 2075405..2076385 (-) | 981 | WP_015082934.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=847444 LLA22_RS10560 WP_014573336.1 2073695..2073883(-) (comGD) [Lactococcus cremoris strain A.2.2]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=847444 LLA22_RS10560 WP_014573336.1 2073695..2073883(-) (comGD) [Lactococcus cremoris strain A.2.2]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |