Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   QRA13_RS19920 Genome accession   NZ_CP128184
Coordinates   4023595..4023861 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain YJ0-1 isolate soil     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 4018595..4028861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRA13_RS19900 (QRA13_19900) - 4018860..4020161 (-) 1302 WP_020956081.1 hemolysin family protein -
  QRA13_RS19905 (QRA13_19905) - 4020307..4021257 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  QRA13_RS19910 (QRA13_19910) comGA 4021454..4022524 (+) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  QRA13_RS19915 (QRA13_19915) comGB 4022511..4023548 (+) 1038 WP_266121854.1 competence type IV pilus assembly protein ComGB Machinery gene
  QRA13_RS19920 (QRA13_19920) comGC 4023595..4023861 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  QRA13_RS19925 (QRA13_19925) comGD 4023851..4024288 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QRA13_RS19930 (QRA13_19930) comGE 4024272..4024586 (+) 315 WP_266121853.1 competence type IV pilus minor pilin ComGE -
  QRA13_RS19935 (QRA13_19935) comGF 4024495..4024995 (+) 501 WP_266121852.1 competence type IV pilus minor pilin ComGF -
  QRA13_RS19940 (QRA13_19940) comGG 4024996..4025373 (+) 378 WP_266121851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QRA13_RS19945 (QRA13_19945) - 4025430..4025609 (+) 180 WP_003153093.1 YqzE family protein -
  QRA13_RS19950 (QRA13_19950) - 4025650..4025979 (-) 330 WP_038459175.1 DUF3889 domain-containing protein -
  QRA13_RS19955 (QRA13_19955) tapA 4026238..4026909 (+) 672 WP_266121850.1 amyloid fiber anchoring/assembly protein TapA -
  QRA13_RS19960 (QRA13_19960) - 4026881..4027465 (+) 585 WP_015240205.1 signal peptidase I SipW -
  QRA13_RS19965 (QRA13_19965) - 4027530..4028315 (+) 786 WP_044802563.1 biofilm matrix protein TasA -
  QRA13_RS19970 (QRA13_19970) sinR 4028363..4028698 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=846542 QRA13_RS19920 WP_042635730.1 4023595..4023861(+) (comGC) [Bacillus velezensis strain YJ0-1 isolate soil]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=846542 QRA13_RS19920 WP_042635730.1 4023595..4023861(+) (comGC) [Bacillus velezensis strain YJ0-1 isolate soil]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATTACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACTGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602