Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | QRE63_RS11515 | Genome accession | NZ_CP128129 |
| Coordinates | 2233616..2233894 (+) | Length | 92 a.a. |
| NCBI ID | WP_002192986.1 | Uniprot ID | A0A328KXS6 |
| Organism | Bacillus mycoides strain SIN2.2 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2225152..2268638 | 2233616..2233894 | within | 0 |
Gene organization within MGE regions
Location: 2225152..2268638
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRE63_RS11435 (QRE63_11460) | gnd | 2225152..2226048 (+) | 897 | WP_002189506.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| QRE63_RS11440 (QRE63_11465) | - | 2226202..2226738 (+) | 537 | WP_002031805.1 | NADPH-dependent FMN reductase | - |
| QRE63_RS11445 (QRE63_11470) | - | 2226740..2227459 (+) | 720 | Protein_2172 | MFS transporter | - |
| QRE63_RS11450 (QRE63_11475) | - | 2227477..2228538 (-) | 1062 | WP_002192999.1 | site-specific integrase | - |
| QRE63_RS11455 (QRE63_11480) | - | 2228614..2229243 (-) | 630 | WP_002192998.1 | XRE family transcriptional regulator | - |
| QRE63_RS11460 (QRE63_11485) | - | 2229403..2229630 (+) | 228 | WP_002192996.1 | helix-turn-helix transcriptional regulator | - |
| QRE63_RS11465 (QRE63_11490) | - | 2229781..2229969 (+) | 189 | WP_002192995.1 | helix-turn-helix domain-containing protein | - |
| QRE63_RS11470 (QRE63_11495) | - | 2229989..2230156 (+) | 168 | WP_002192994.1 | hypothetical protein | - |
| QRE63_RS11475 (QRE63_11500) | - | 2230157..2230312 (+) | 156 | WP_181462949.1 | hypothetical protein | - |
| QRE63_RS11480 (QRE63_11505) | - | 2230329..2231093 (+) | 765 | WP_002192993.1 | phage regulatory protein | - |
| QRE63_RS11485 (QRE63_11510) | - | 2231106..2231303 (+) | 198 | WP_002192992.1 | hypothetical protein | - |
| QRE63_RS11490 (QRE63_11515) | - | 2231340..2231522 (+) | 183 | WP_113709520.1 | hypothetical protein | - |
| QRE63_RS11495 (QRE63_11520) | - | 2231534..2231710 (+) | 177 | WP_002192990.1 | hypothetical protein | - |
| QRE63_RS11500 (QRE63_11525) | - | 2231717..2232598 (+) | 882 | WP_002192989.1 | DnaD domain protein | - |
| QRE63_RS11505 (QRE63_11530) | - | 2232540..2233403 (+) | 864 | WP_002192988.1 | ATP-binding protein | - |
| QRE63_RS11510 (QRE63_11535) | - | 2233406..2233600 (+) | 195 | WP_002192987.1 | hypothetical protein | - |
| QRE63_RS11515 (QRE63_11540) | abrB | 2233616..2233894 (+) | 279 | WP_002192986.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| QRE63_RS11520 (QRE63_11545) | - | 2233887..2234246 (+) | 360 | WP_002192985.1 | hypothetical protein | - |
| QRE63_RS11525 (QRE63_11550) | - | 2234265..2234432 (+) | 168 | WP_002192984.1 | DUF3954 domain-containing protein | - |
| QRE63_RS11530 (QRE63_11555) | - | 2234458..2234709 (+) | 252 | WP_113709519.1 | helix-turn-helix domain containing protein | - |
| QRE63_RS11535 (QRE63_11560) | - | 2234729..2235184 (+) | 456 | WP_286099327.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| QRE63_RS11540 (QRE63_11565) | - | 2235225..2235602 (+) | 378 | WP_002192980.1 | YopX family protein | - |
| QRE63_RS11545 (QRE63_11570) | - | 2235775..2236356 (+) | 582 | WP_002192979.1 | hypothetical protein | - |
| QRE63_RS11550 (QRE63_11575) | - | 2236531..2236767 (+) | 237 | WP_002192978.1 | hypothetical protein | - |
| QRE63_RS11555 (QRE63_11580) | - | 2237142..2237297 (+) | 156 | WP_002192976.1 | hypothetical protein | - |
| QRE63_RS11560 (QRE63_11585) | - | 2237333..2237632 (+) | 300 | WP_002192975.1 | hypothetical protein | - |
| QRE63_RS11565 (QRE63_11590) | - | 2237808..2238113 (+) | 306 | WP_002192974.1 | hypothetical protein | - |
| QRE63_RS11570 (QRE63_11595) | - | 2238253..2238480 (+) | 228 | WP_002192973.1 | hypothetical protein | - |
| QRE63_RS11575 (QRE63_11600) | - | 2238605..2238961 (+) | 357 | WP_002192972.1 | hypothetical protein | - |
| QRE63_RS11580 (QRE63_11605) | - | 2239000..2239122 (+) | 123 | WP_002192971.1 | DUF3983 domain-containing protein | - |
| QRE63_RS11585 (QRE63_11610) | - | 2239236..2239406 (+) | 171 | WP_002192970.1 | hypothetical protein | - |
| QRE63_RS11590 (QRE63_11615) | - | 2239427..2239897 (+) | 471 | WP_002192969.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QRE63_RS11595 (QRE63_11620) | - | 2239894..2240436 (+) | 543 | WP_002192968.1 | tyrosine-type recombinase/integrase | - |
| QRE63_RS11600 (QRE63_11625) | - | 2240660..2241826 (+) | 1167 | WP_113709518.1 | hypothetical protein | - |
| QRE63_RS11605 (QRE63_11635) | - | 2242235..2242402 (+) | 168 | WP_181462948.1 | hypothetical protein | - |
| QRE63_RS11610 (QRE63_11640) | - | 2242405..2242716 (+) | 312 | WP_113709517.1 | HNH endonuclease signature motif containing protein | - |
| QRE63_RS11615 (QRE63_11645) | - | 2242720..2243019 (+) | 300 | WP_113709516.1 | hypothetical protein | - |
| QRE63_RS11620 (QRE63_11650) | - | 2243126..2243437 (+) | 312 | WP_002192964.1 | P27 family phage terminase small subunit | - |
| QRE63_RS11625 (QRE63_11655) | - | 2243430..2245073 (+) | 1644 | WP_002192963.1 | terminase TerL endonuclease subunit | - |
| QRE63_RS11630 (QRE63_11660) | - | 2245090..2246277 (+) | 1188 | WP_113709515.1 | phage portal protein | - |
| QRE63_RS11635 (QRE63_11665) | - | 2246249..2246983 (+) | 735 | WP_002192961.1 | head maturation protease, ClpP-related | - |
| QRE63_RS11640 (QRE63_11670) | - | 2247024..2248166 (+) | 1143 | WP_113709514.1 | phage major capsid protein | - |
| QRE63_RS11645 (QRE63_11675) | - | 2248147..2248326 (+) | 180 | WP_142936362.1 | hypothetical protein | - |
| QRE63_RS11650 (QRE63_11680) | - | 2248328..2248633 (+) | 306 | WP_033733047.1 | head-tail connector protein | - |
| QRE63_RS11655 (QRE63_11685) | - | 2248617..2248964 (+) | 348 | WP_000844459.1 | hypothetical protein | - |
| QRE63_RS11660 (QRE63_11690) | - | 2248954..2249340 (+) | 387 | WP_002192958.1 | hypothetical protein | - |
| QRE63_RS11665 (QRE63_11695) | - | 2249330..2249752 (+) | 423 | WP_113709513.1 | hypothetical protein | - |
| QRE63_RS11670 (QRE63_11700) | - | 2249755..2250330 (+) | 576 | WP_176527028.1 | phage tail protein | - |
| QRE63_RS11675 (QRE63_11705) | - | 2250377..2250829 (+) | 453 | WP_002192955.1 | hypothetical protein | - |
| QRE63_RS11680 (QRE63_11710) | - | 2251012..2255220 (+) | 4209 | WP_002192954.1 | hypothetical protein | - |
| QRE63_RS11685 (QRE63_11715) | - | 2255222..2255905 (+) | 684 | WP_002192953.1 | phage tail domain-containing protein | - |
| QRE63_RS11690 (QRE63_11720) | - | 2255902..2258331 (+) | 2430 | WP_002192952.1 | phage tail spike protein | - |
| QRE63_RS11695 (QRE63_11725) | - | 2258354..2259517 (+) | 1164 | WP_002192951.1 | BppU family phage baseplate upper protein | - |
| QRE63_RS11700 (QRE63_11730) | - | 2259534..2259959 (+) | 426 | WP_002192693.1 | phage holin family protein | - |
| QRE63_RS11705 (QRE63_11735) | - | 2259959..2260729 (+) | 771 | WP_286099328.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QRE63_RS11710 (QRE63_11740) | - | 2260959..2261441 (-) | 483 | WP_113709511.1 | hypothetical protein | - |
| QRE63_RS11715 (QRE63_11745) | - | 2261467..2261838 (+) | 372 | Protein_2226 | N-acetylmuramoyl-L-alanine amidase | - |
| QRE63_RS11720 (QRE63_11750) | - | 2261915..2262367 (-) | 453 | WP_002192946.1 | YrhA family protein | - |
| QRE63_RS11725 (QRE63_11755) | - | 2262508..2263080 (-) | 573 | WP_002192944.1 | DUF1629 domain-containing protein | - |
| QRE63_RS11730 (QRE63_11760) | - | 2263507..2264112 (-) | 606 | WP_002192942.1 | hypothetical protein | - |
| QRE63_RS11735 (QRE63_11765) | - | 2264167..2265042 (-) | 876 | WP_002192941.1 | DUF3994 domain-containing protein | - |
| QRE63_RS11740 (QRE63_11770) | - | 2265264..2266094 (-) | 831 | WP_002192940.1 | hypothetical protein | - |
| QRE63_RS11745 (QRE63_11775) | - | 2266404..2266967 (+) | 564 | Protein_2232 | macrolide transporter | - |
| QRE63_RS11750 (QRE63_11780) | - | 2267031..2267588 (+) | 558 | WP_078176560.1 | YdcF family protein | - |
| QRE63_RS11755 (QRE63_11785) | - | 2267691..2268638 (+) | 948 | WP_033709046.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10135.71 Da Isoelectric Point: 6.2257
>NTDB_id=846152 QRE63_RS11515 WP_002192986.1 2233616..2233894(+) (abrB) [Bacillus mycoides strain SIN2.2]
MKNTGVARKVDDLGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVSESNIELLDGRMFLSKKGASEL
LDLLEKSVMTHA
MKNTGVARKVDDLGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVSESNIELLDGRMFLSKKGASEL
LDLLEKSVMTHA
Nucleotide
Download Length: 279 bp
>NTDB_id=846152 QRE63_RS11515 WP_002192986.1 2233616..2233894(+) (abrB) [Bacillus mycoides strain SIN2.2]
GTGAAAAACACAGGTGTTGCAAGAAAAGTGGACGATCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGAACAGCATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACAGGTGAAGTTTCTGAATCAAACATAGAATTGCTGGACGGACGAATGTTTTTGAGTAAGAAAGGGGCAAGTGAGTTA
CTGGACCTTCTTGAAAAGAGTGTGATGACACATGCCTAA
GTGAAAAACACAGGTGTTGCAAGAAAAGTGGACGATCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGAACAGCATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACAGGTGAAGTTTCTGAATCAAACATAGAATTGCTGGACGGACGAATGTTTTTGAGTAAGAAAGGGGCAAGTGAGTTA
CTGGACCTTCTTGAAAAGAGTGTGATGACACATGCCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.831 |
90.217 |
0.522 |