Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QRD86_RS13190 Genome accession   NZ_CP128116
Coordinates   2486466..2486813 (-) Length   115 a.a.
NCBI ID   WP_106020095.1    Uniprot ID   -
Organism   Bacillus halotolerans strain KF17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2481466..2491813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRD86_RS13145 (QRD86_13140) sinI 2481991..2482164 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  QRD86_RS13150 (QRD86_13145) sinR 2482198..2482533 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QRD86_RS13155 (QRD86_13150) tasA 2482620..2483405 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  QRD86_RS13160 (QRD86_13155) - 2483470..2484054 (-) 585 WP_105955579.1 signal peptidase I SipW -
  QRD86_RS13165 (QRD86_13160) tapA 2484026..2484787 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  QRD86_RS13170 (QRD86_13165) - 2485065..2485388 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  QRD86_RS13175 (QRD86_13170) - 2485431..2485610 (-) 180 WP_003236949.1 YqzE family protein -
  QRD86_RS13180 (QRD86_13175) comGG 2485682..2486056 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  QRD86_RS13185 (QRD86_13180) comGF 2486057..2486440 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  QRD86_RS13190 (QRD86_13185) comGE 2486466..2486813 (-) 348 WP_106020095.1 competence type IV pilus minor pilin ComGE Machinery gene
  QRD86_RS13195 (QRD86_13190) comGD 2486797..2487228 (-) 432 WP_255003480.1 competence type IV pilus minor pilin ComGD Machinery gene
  QRD86_RS13200 (QRD86_13195) comGC 2487218..2487514 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  QRD86_RS13205 (QRD86_13200) comGB 2487528..2488565 (-) 1038 WP_106020096.1 competence type IV pilus assembly protein ComGB Machinery gene
  QRD86_RS13210 (QRD86_13205) comGA 2488552..2489622 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  QRD86_RS13215 (QRD86_13210) - 2489943..2490353 (-) 411 WP_106020097.1 CBS domain-containing protein -
  QRD86_RS13220 (QRD86_13215) - 2490416..2491369 (-) 954 WP_255003483.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13239.09 Da        Isoelectric Point: 4.3566

>NTDB_id=846039 QRD86_RS13190 WP_106020095.1 2486466..2486813(-) (comGE) [Bacillus halotolerans strain KF17]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREMGYQLVNESIGKYMLTGAGDSSQTVSMNNSKYSMT
WEEEGEYQNVCITSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=846039 QRD86_RS13190 WP_106020095.1 2486466..2486813(-) (comGE) [Bacillus halotolerans strain KF17]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTGTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGCGAGAAATGGGTTATCAGCTTGTTAATGAAA
GCATAGGCAAATATATGCTGACAGGAGCAGGAGATTCGTCACAAACTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAGAGTATCAAAACGTATGCATCACATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

70.435

100

0.704