Detailed information NTG0845744

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: V2176_RS11705
• Genome accession: NZ_CP143963
• Coordinates: 2226679..2227116 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain FUA2151
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2221679..2232116

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V2176_RS11655 (V2176_11655)	sinI	2221854..2222030 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
V2176_RS11660 (V2176_11660)	sinR	2222064..2222399 (+)	336	WP_025804940.1	transcriptional regulator SinR	Regulator
V2176_RS11665 (V2176_11665)	tasA	2222504..2223298 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
V2176_RS11670 (V2176_11670)	sipW	2223372..2223956 (-)	585	WP_003183449.1	signal peptidase I SipW	-
V2176_RS11675 (V2176_11675)	tapA	2223953..2224681 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
V2176_RS11680 (V2176_11680)	-	2224958..2225278 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
V2176_RS11685 (V2176_11685)	-	2225302..2225484 (-)	183	WP_003183456.1	YqzE family protein	-
V2176_RS11690 (V2176_11690)	comGG	2225573..2225938 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
V2176_RS11695 (V2176_11695)	comGF	2225951..2226439 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
V2176_RS11700 (V2176_11700)	comGE	2226348..2226695 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
V2176_RS11705 (V2176_11705)	comGD	2226679..2227116 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
V2176_RS11710 (V2176_11710)	comGC	2227122..2227415 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
V2176_RS11715 (V2176_11715)	comGB	2227429..2228463 (-)	1035	WP_330937851.1	competence type IV pilus assembly protein ComGB	Machinery gene
V2176_RS11720 (V2176_11720)	comGA	2228453..2229517 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
V2176_RS11725 (V2176_11725)	-	2229674..2230513 (-)	840	WP_003183480.1	STAS domain-containing protein	-
V2176_RS11735 (V2176_11735)	-	2230755..2231132 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
V2176_RS11740 (V2176_11740)	-	2231341..2231586 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=845744 V2176_RS11705 WP_009327905.1 2226679..2227116(-) (comGD) [Bacillus licheniformis strain FUA2151]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=845744 V2176_RS11705 WP_009327905.1 2226679..2227116(-) (comGD) [Bacillus licheniformis strain FUA2151]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393