Detailed information NTG0844913

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QQ988_RS06220
• Genome accession: NZ_CP127869
• Coordinates: 1288692..1289009 (+)
• Length: 105 a.a.
• NCBI ID: WP_001831271.1
• Uniprot ID: A0A9Q5JKE9
• Organism: Staphylococcus epidermidis strain NG02
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1283692..1294009

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QQ988_RS06190 (QQ988_06190)	-	1284469..1284669 (+)	201	WP_002446537.1	YqgQ family protein	-
QQ988_RS06195 (QQ988_06195)	-	1284669..1285655 (+)	987	WP_002473556.1	ROK family glucokinase	-
QQ988_RS06200 (QQ988_06200)	-	1285655..1285981 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
QQ988_RS06205 (QQ988_06205)	-	1285981..1286604 (+)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
QQ988_RS06210 (QQ988_06210)	comGA	1286661..1287635 (+)	975	WP_161388069.1	competence type IV pilus ATPase ComGA	Machinery gene
QQ988_RS06215 (QQ988_06215)	comGB	1287607..1288674 (+)	1068	WP_002497932.1	competence type IV pilus assembly protein ComGB	Machinery gene
QQ988_RS06220 (QQ988_06220)	comGC	1288692..1289009 (+)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
QQ988_RS06225 (QQ988_06225)	comGD	1288999..1289436 (+)	438	WP_161388070.1	competence type IV pilus minor pilin ComGD	-
QQ988_RS06230 (QQ988_06230)	-	1289423..1289716 (+)	294	WP_001831116.1	hypothetical protein	-
QQ988_RS06235 (QQ988_06235)	-	1289640..1290131 (+)	492	WP_059223718.1	competence type IV pilus minor pilin ComGF	-
QQ988_RS06240 (QQ988_06240)	-	1290296..1290808 (+)	513	WP_002497929.1	shikimate kinase	-
QQ988_RS06245 (QQ988_06245)	gcvT	1291026..1292117 (+)	1092	WP_237635261.1	glycine cleavage system aminomethyltransferase GcvT	-
QQ988_RS06250 (QQ988_06250)	gcvPA	1292137..1293483 (+)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=844913 QQ988_RS06220 WP_001831271.1 1288692..1289009(+) (comGC) [Staphylococcus epidermidis strain NG02]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=844913 QQ988_RS06220 WP_001831271.1 1288692..1289009(+) (comGC) [Staphylococcus epidermidis strain NG02]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTATGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362