Detailed information NTG0844591

Bioinformatically predicted

Overview

• Name: comS
• Type: Regulator
• Locus tag: QRS93_RS00290
• Genome accession: NZ_CP127842
• Coordinates: 51067..51162 (+)
• Length: 31 a.a.
• NCBI ID: WP_198455558.1
• Uniprot ID: -
• Organism: Streptococcus dysgalactiae subsp. equisimilis strain TPCH-F37
• Function: activate transcription of comX (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	51266..52399	51067..51162	flank	104

Gene organization within MGE regions

Location: 51067..52399

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QRS93_RS00290 (QRS93_00290)	comS	51067..51162 (+)	96	WP_198455558.1	quorum-sensing system DWW-type pheromone	Regulator
QRS93_RS00295 (QRS93_00295)	-	51266..52399 (+)	1134	WP_042358021.1	ISAs1-like element IS1548 family transposase	-

Sequence

Protein

• Length: 31 a.a.
• Molecular weight: 3929.72 Da
• Isoelectric Point: 10.1669

>NTDB_id=844591 QRS93_RS00290 WP_198455558.1 51067..51162(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-F37]
MFKRYHYYFILTAMLAFKAAQMISQVDWWRL

Nucleotide

• Length: 96 bp

>NTDB_id=844591 QRS93_RS00290 WP_198455558.1 51067..51162(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-F37]
ATGTTCAAAAGATATCACTACTATTTTATACTTACTGCTATGTTAGCATTTAAAGCAGCTCAGATGATAAGTCAAGTGGA
TTGGTGGCGTTTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comS	Streptococcus pyogenes MGAS8232	61.29	100	0.613
comS	Streptococcus pyogenes MGAS315	38.71	100	0.387