Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NSY31_RS11850 Genome accession   NZ_CP127834
Coordinates   2456471..2456785 (-) Length   104 a.a.
NCBI ID   WP_080130386.1    Uniprot ID   -
Organism   Bacillus velezensis strain Ag109     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2451471..2461785
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSY31_RS11805 (NSY31_11805) sinI 2452153..2452326 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NSY31_RS11810 (NSY31_11810) sinR 2452360..2452695 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NSY31_RS11815 (NSY31_11815) - 2452743..2453528 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NSY31_RS11820 (NSY31_11820) - 2453593..2454177 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NSY31_RS11825 (NSY31_11825) tapA 2454149..2454820 (-) 672 WP_063094776.1 amyloid fiber anchoring/assembly protein TapA -
  NSY31_RS11830 (NSY31_11830) - 2455079..2455408 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NSY31_RS11835 (NSY31_11835) - 2455448..2455627 (-) 180 WP_003153093.1 YqzE family protein -
  NSY31_RS11840 (NSY31_11840) comGG 2455684..2456061 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  NSY31_RS11845 (NSY31_11845) comGF 2456062..2456562 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  NSY31_RS11850 (NSY31_11850) comGE 2456471..2456785 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  NSY31_RS11855 (NSY31_11855) comGD 2456769..2457206 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  NSY31_RS11860 (NSY31_11860) comGC 2457196..2457504 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NSY31_RS11865 (NSY31_11865) comGB 2457509..2458546 (-) 1038 WP_098081583.1 competence type IV pilus assembly protein ComGB Machinery gene
  NSY31_RS11870 (NSY31_11870) comGA 2458533..2459603 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NSY31_RS11875 (NSY31_11875) - 2459796..2460746 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11883.88 Da        Isoelectric Point: 7.1308

>NTDB_id=844532 NSY31_RS11850 WP_080130386.1 2456471..2456785(-) (comGE) [Bacillus velezensis strain Ag109]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRHEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=844532 NSY31_RS11850 WP_080130386.1 2456471..2456785(-) (comGE) [Bacillus velezensis strain Ag109]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCATGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481