Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   QQ984_RS18395 Genome accession   NZ_CP127223
Coordinates   3497869..3498153 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain Jrh14-10     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3451597..3499537 3497869..3498153 within 0


Gene organization within MGE regions


Location: 3451597..3499537
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQ984_RS18100 (QQ984_18100) - 3451597..3451965 (+) 369 WP_081112712.1 YolD-like family protein -
  QQ984_RS18105 (QQ984_18105) - 3452188..3453309 (-) 1122 WP_035338316.1 Rap family tetratricopeptide repeat protein -
  QQ984_RS18110 (QQ984_18110) - 3453565..3455082 (+) 1518 WP_069500776.1 T7SS effector LXG polymorphic toxin -
  QQ984_RS18115 (QQ984_18115) - 3455113..3455451 (+) 339 WP_017474559.1 hypothetical protein -
  QQ984_RS18120 (QQ984_18120) - 3455579..3456532 (-) 954 WP_025808202.1 glycoside hydrolase family 25 protein -
  QQ984_RS18125 (QQ984_18125) - 3456579..3456842 (-) 264 WP_009329191.1 phage holin -
  QQ984_RS18130 (QQ984_18130) - 3456858..3457127 (-) 270 WP_009329192.1 hemolysin XhlA family protein -
  QQ984_RS18135 (QQ984_18135) - 3457190..3457372 (-) 183 WP_017474775.1 XkdX family protein -
  QQ984_RS18140 (QQ984_18140) - 3457369..3457692 (-) 324 WP_069500777.1 hypothetical protein -
  QQ984_RS18145 (QQ984_18145) - 3457705..3459144 (-) 1440 WP_069500778.1 BppU family phage baseplate upper protein -
  QQ984_RS18150 (QQ984_18150) - 3459165..3461210 (-) 2046 WP_069500779.1 hypothetical protein -
  QQ984_RS18155 (QQ984_18155) - 3461247..3462959 (-) 1713 WP_069500780.1 phage tail protein -
  QQ984_RS18160 (QQ984_18160) - 3462972..3463808 (-) 837 WP_285977026.1 phage tail family protein -
  QQ984_RS18165 (QQ984_18165) - 3463808..3468280 (-) 4473 WP_088273058.1 phage tail tape measure protein -
  QQ984_RS18170 (QQ984_18170) - 3468489..3468851 (-) 363 WP_003185339.1 hypothetical protein -
  QQ984_RS18175 (QQ984_18175) - 3468905..3469522 (-) 618 WP_003185341.1 major tail protein -
  QQ984_RS18180 (QQ984_18180) - 3469537..3469920 (-) 384 WP_006637250.1 phage protein -
  QQ984_RS18185 (QQ984_18185) - 3469917..3470315 (-) 399 WP_006637249.1 HK97-gp10 family putative phage morphogenesis protein -
  QQ984_RS18190 (QQ984_18190) - 3470315..3470623 (-) 309 WP_006637248.1 phage head closure protein -
  QQ984_RS18195 (QQ984_18195) - 3470613..3470915 (-) 303 WP_006637247.1 head-tail connector protein -
  QQ984_RS18200 (QQ984_18200) - 3470936..3471364 (-) 429 WP_006637246.1 collagen-like protein -
  QQ984_RS18205 (QQ984_18205) - 3471388..3472671 (-) 1284 WP_006637245.1 phage major capsid protein -
  QQ984_RS18210 (QQ984_18210) - 3472710..3473441 (-) 732 WP_006637244.1 head maturation protease, ClpP-related -
  QQ984_RS18215 (QQ984_18215) - 3473386..3474696 (-) 1311 WP_006637243.1 phage portal protein -
  QQ984_RS18220 (QQ984_18220) - 3474697..3474888 (-) 192 WP_006637242.1 DUF1056 family protein -
  QQ984_RS18225 (QQ984_18225) - 3474900..3476609 (-) 1710 WP_061578330.1 terminase TerL endonuclease subunit -
  QQ984_RS18230 (QQ984_18230) - 3476606..3477121 (-) 516 WP_069500782.1 phage terminase small subunit P27 family -
  QQ984_RS18235 (QQ984_18235) - 3477353..3477727 (-) 375 WP_088272692.1 HNH endonuclease -
  QQ984_RS18240 (QQ984_18240) - 3478205..3478852 (-) 648 WP_048407182.1 hypothetical protein -
  QQ984_RS18245 (QQ984_18245) - 3479277..3479657 (-) 381 WP_088272691.1 ArpU family phage packaging/lysis transcriptional regulator -
  QQ984_RS18250 (QQ984_18250) - 3479770..3480147 (-) 378 WP_088272690.1 YopX family protein -
  QQ984_RS18255 (QQ984_18255) - 3480163..3480678 (-) 516 WP_025807625.1 putative metallopeptidase -
  QQ984_RS18260 (QQ984_18260) - 3480681..3480851 (-) 171 WP_071583658.1 Fur-regulated basic protein FbpA -
  QQ984_RS18265 (QQ984_18265) - 3480848..3481387 (-) 540 WP_025807627.1 ERCC4 domain-containing protein -
  QQ984_RS18270 (QQ984_18270) - 3481384..3481821 (-) 438 WP_025807629.1 hypothetical protein -
  QQ984_RS18275 (QQ984_18275) - 3481799..3482062 (-) 264 WP_025807631.1 hypothetical protein -
  QQ984_RS18280 (QQ984_18280) - 3482339..3484771 (-) 2433 WP_285977027.1 phage/plasmid primase, P4 family -
  QQ984_RS18285 (QQ984_18285) - 3484832..3485269 (-) 438 WP_061576092.1 DUF669 domain-containing protein -
  QQ984_RS18290 (QQ984_18290) - 3485269..3486201 (-) 933 WP_061565941.1 AAA family ATPase -
  QQ984_RS18295 (QQ984_18295) - 3486205..3486762 (-) 558 WP_088272689.1 host-nuclease inhibitor Gam family protein -
  QQ984_RS18300 (QQ984_18300) - 3486862..3487104 (-) 243 WP_011198322.1 hypothetical protein -
  QQ984_RS18305 (QQ984_18305) - 3487192..3487458 (-) 267 WP_009330095.1 YqaH family protein -
  QQ984_RS18310 (QQ984_18310) - 3487513..3487827 (+) 315 WP_048406869.1 hypothetical protein -
  QQ984_RS18315 (QQ984_18315) - 3487899..3488144 (-) 246 WP_048407027.1 hypothetical protein -
  QQ984_RS18320 (QQ984_18320) - 3488191..3488346 (-) 156 WP_155759051.1 hypothetical protein -
  QQ984_RS18325 (QQ984_18325) - 3488402..3488692 (+) 291 WP_017474699.1 hypothetical protein -
  QQ984_RS18330 (QQ984_18330) - 3488679..3488843 (-) 165 WP_017474700.1 hypothetical protein -
  QQ984_RS18335 (QQ984_18335) - 3488995..3489549 (-) 555 WP_003185401.1 hypothetical protein -
  QQ984_RS18340 (QQ984_18340) - 3489607..3489795 (-) 189 WP_016886536.1 hypothetical protein -
  QQ984_RS18345 (QQ984_18345) - 3489927..3490115 (-) 189 WP_003185403.1 helix-turn-helix domain-containing protein -
  QQ984_RS18350 (QQ984_18350) - 3490112..3490906 (-) 795 WP_035317292.1 ORF6N domain-containing protein -
  QQ984_RS18355 (QQ984_18355) - 3490929..3491147 (-) 219 WP_003185407.1 helix-turn-helix transcriptional regulator -
  QQ984_RS18360 (QQ984_18360) - 3491324..3491962 (+) 639 WP_069500786.1 XRE family transcriptional regulator -
  QQ984_RS18365 (QQ984_18365) - 3492033..3493127 (+) 1095 WP_003185410.1 site-specific integrase -
  QQ984_RS18375 (QQ984_18375) smpB 3493679..3494152 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  QQ984_RS18380 (QQ984_18380) rnr 3494264..3496567 (-) 2304 WP_003185414.1 ribonuclease R -
  QQ984_RS18385 (QQ984_18385) - 3496581..3497327 (-) 747 WP_003185416.1 carboxylesterase -
  QQ984_RS18390 (QQ984_18390) secG 3497468..3497698 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  QQ984_RS18395 (QQ984_18395) abrB 3497869..3498153 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  QQ984_RS18400 (QQ984_18400) - 3498182..3498415 (-) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  QQ984_RS18405 (QQ984_18405) - 3498568..3498969 (+) 402 WP_009329609.1 transcriptional regulator -
  QQ984_RS18410 (QQ984_18410) - 3499139..3499537 (+) 399 WP_009329610.1 helix-turn-helix transcriptional regulator -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=842761 QQ984_RS18395 WP_003185421.1 3497869..3498153(-) (abrB) [Bacillus licheniformis strain Jrh14-10]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=842761 QQ984_RS18395 WP_003185421.1 3497869..3498153(-) (abrB) [Bacillus licheniformis strain Jrh14-10]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543