Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QQ984_RS13480 Genome accession   NZ_CP127223
Coordinates   2584089..2584265 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain Jrh14-10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2579089..2589265
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQ984_RS13465 (QQ984_13465) gcvT 2579731..2580825 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  QQ984_RS13470 (QQ984_13470) - 2581418..2583097 (+) 1680 WP_003183439.1 SNF2-related protein -
  QQ984_RS13475 (QQ984_13475) - 2583104..2583898 (+) 795 WP_003183441.1 YqhG family protein -
  QQ984_RS13480 (QQ984_13480) sinI 2584089..2584265 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  QQ984_RS13485 (QQ984_13485) sinR 2584299..2584634 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  QQ984_RS13490 (QQ984_13490) - 2584739..2585533 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  QQ984_RS13495 (QQ984_13495) - 2585607..2586191 (-) 585 WP_003183449.1 signal peptidase I SipW -
  QQ984_RS13500 (QQ984_13500) tapA 2586188..2586916 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  QQ984_RS13505 (QQ984_13505) - 2587226..2587513 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  QQ984_RS13510 (QQ984_13510) - 2587543..2587725 (-) 183 WP_003183456.1 YqzE family protein -
  QQ984_RS13515 (QQ984_13515) comGG 2587814..2588179 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  QQ984_RS13520 (QQ984_13520) comGF 2588192..2588680 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  QQ984_RS13525 (QQ984_13525) comGE 2588589..2588936 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=842741 QQ984_RS13480 WP_003183444.1 2584089..2584265(+) (sinI) [Bacillus licheniformis strain Jrh14-10]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=842741 QQ984_RS13480 WP_003183444.1 2584089..2584265(+) (sinI) [Bacillus licheniformis strain Jrh14-10]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517