Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QQ974_RS11645 | Genome accession | NZ_CP127164 |
| Coordinates | 2435502..2435675 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain B14 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2430502..2440675
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ974_RS11630 (QQ974_11630) | gcvT | 2431316..2432416 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QQ974_RS11635 (QQ974_11635) | - | 2432839..2434509 (+) | 1671 | WP_032874031.1 | SNF2-related protein | - |
| QQ974_RS11640 (QQ974_11640) | - | 2434531..2435325 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| QQ974_RS11645 (QQ974_11645) | sinI | 2435502..2435675 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| QQ974_RS11650 (QQ974_11650) | sinR | 2435709..2436044 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| QQ974_RS11655 (QQ974_11655) | - | 2436092..2436877 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| QQ974_RS11660 (QQ974_11660) | - | 2436942..2437526 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| QQ974_RS11665 (QQ974_11665) | tapA | 2437498..2438169 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QQ974_RS11670 (QQ974_11670) | - | 2438428..2438757 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| QQ974_RS11675 (QQ974_11675) | - | 2438798..2438977 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| QQ974_RS11680 (QQ974_11680) | comGG | 2439034..2439411 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QQ974_RS11685 (QQ974_11685) | comGF | 2439412..2439912 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| QQ974_RS11690 (QQ974_11690) | comGE | 2439821..2440135 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| QQ974_RS11695 (QQ974_11695) | comGD | 2440119..2440556 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=842257 QQ974_RS11645 WP_032874029.1 2435502..2435675(+) (sinI) [Bacillus velezensis strain B14]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=842257 QQ974_RS11645 WP_032874029.1 2435502..2435675(+) (sinI) [Bacillus velezensis strain B14]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |