Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QQW97_RS16395 Genome accession   NZ_CP127089
Coordinates   3054748..3054888 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KK026     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3049748..3059888
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQW97_RS16370 (QQW97_16355) yuxO 3050061..3050441 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  QQW97_RS16375 (QQW97_16360) comA 3050460..3051104 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QQW97_RS16380 (QQW97_16365) comP 3051185..3053494 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  QQW97_RS16385 (QQW97_16370) comX 3053509..3053676 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  QQW97_RS16390 (QQW97_16375) comQ 3053664..3054563 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  QQW97_RS16395 (QQW97_16380) degQ 3054748..3054888 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QQW97_RS16400 (QQW97_16385) - 3055110..3055235 (+) 126 WP_003228793.1 hypothetical protein -
  QQW97_RS16405 (QQW97_16390) - 3055349..3055717 (+) 369 WP_003243784.1 hypothetical protein -
  QQW97_RS16410 (QQW97_16395) pdeH 3055693..3056922 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QQW97_RS16415 (QQW97_16400) pncB 3057059..3058531 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QQW97_RS16420 (QQW97_16405) pncA 3058547..3059098 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  QQW97_RS16425 (QQW97_16410) yueI 3059195..3059593 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=841559 QQW97_RS16395 WP_003220708.1 3054748..3054888(-) (degQ) [Bacillus subtilis strain KK026]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=841559 QQW97_RS16395 WP_003220708.1 3054748..3054888(-) (degQ) [Bacillus subtilis strain KK026]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1