Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLC_RS09355 | Genome accession | NZ_AP024222 |
| Coordinates | 1849143..1849370 (+) | Length | 75 a.a. |
| NCBI ID | WP_228764408.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain EPSC | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1849253..1861784 | 1849143..1849370 | flank | -117 |
Gene organization within MGE regions
Location: 1849143..1861784
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLC_RS09355 (LLC_19290) | comGG | 1849143..1849370 (+) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLC_RS09360 (LLC_19300) | - | 1849450..1849887 (+) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLC_RS09365 (LLC_19310) | - | 1849884..1850726 (+) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLC_RS09370 (LLC_19320) | - | 1850905..1851642 (+) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLC_RS09375 (LLC_19330) | - | 1851635..1852444 (+) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLC_RS09380 | - | 1852517..1853910 (+) | 1394 | WP_126354656.1 | IS3 family transposase | - |
| LLC_RS09385 (LLC_19360) | - | 1853974..1854846 (-) | 873 | WP_014573331.1 | RluA family pseudouridine synthase | - |
| LLC_RS09390 | - | 1855040..1855417 (+) | 378 | Protein_1854 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LLC_RS09395 (LLC_19380) | - | 1855532..1855963 (+) | 432 | WP_011677172.1 | DUF3290 domain-containing protein | - |
| LLC_RS09400 (LLC_19390) | - | 1855981..1856616 (+) | 636 | WP_011677171.1 | DUF421 domain-containing protein | - |
| LLC_RS09405 (LLC_19400) | - | 1857002..1859233 (+) | 2232 | WP_061777877.1 | PBP1A family penicillin-binding protein | - |
| LLC_RS09410 (LLC_19410) | - | 1859335..1861152 (+) | 1818 | WP_126354658.1 | acyltransferase family protein | - |
| LLC_RS09415 (LLC_19420) | rpmG | 1861193..1861342 (+) | 150 | WP_011677168.1 | 50S ribosomal protein L33 | - |
| LLC_RS09420 (LLC_19430) | secE | 1861454..1861648 (+) | 195 | WP_011677167.1 | preprotein translocase subunit SecE | - |
Sequence
Protein
Download Length: 75 a.a. Molecular weight: 8406.73 Da Isoelectric Point: 9.0864
>NTDB_id=84145 LLC_RS09355 WP_228764408.1 1849143..1849370(+) (comGG) [Lactococcus cremoris strain EPSC]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
Nucleotide
Download Length: 228 bp
>NTDB_id=84145 LLC_RS09355 WP_228764408.1 1849143..1849370(+) (comGG) [Lactococcus cremoris strain EPSC]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
96 |
100 |
0.96 |