Detailed information NTG0084114

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: JG741_RS14345
• Genome accession: NZ_AP024210
• Coordinates: 1848195..1848383 (+)
• Length: 62 a.a.
• NCBI ID: WP_014573336.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain G3-2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	1849266..1861797	1848195..1848383	flank	883

Gene organization within MGE regions

Location: 1848195..1861797

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JG741_RS14345 (LLG32_19270)	comGD	1848195..1848383 (+)	189	WP_014573336.1	hypothetical protein	Machinery gene
JG741_RS09355 (LLG32_19280)	comGE	1848355..1848651 (+)	297	WP_021164977.1	competence type IV pilus minor pilin ComGE	Machinery gene
JG741_RS09360 (LLG32_19290)	comGF	1848635..1849060 (+)	426	WP_014735174.1	competence type IV pilus minor pilin ComGF	Machinery gene
JG741_RS09365 (LLG32_19310)	comGG	1849156..1849383 (+)	228	WP_228764408.1	competence protein ComGG	Machinery gene
JG741_RS09370 (LLG32_19320)	-	1849463..1849900 (+)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
JG741_RS09375 (LLG32_19330)	-	1849897..1850739 (+)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
JG741_RS09380 (LLG32_19340)	-	1850918..1851655 (+)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
JG741_RS09385 (LLG32_19350)	-	1851648..1852457 (+)	810	WP_011677177.1	metal ABC transporter permease	-
JG741_RS09390	-	1852530..1853923 (+)	1394	WP_102032788.1	IS3 family transposase	-
JG741_RS09395 (LLG32_19380)	-	1853987..1854859 (-)	873	WP_014573331.1	RluA family pseudouridine synthase	-
JG741_RS09400	-	1855053..1855430 (+)	378	Protein_1858	pyridoxamine 5'-phosphate oxidase family protein	-
JG741_RS09405 (LLG32_19400)	-	1855545..1855976 (+)	432	WP_011677172.1	DUF3290 domain-containing protein	-
JG741_RS09410 (LLG32_19410)	-	1855994..1856629 (+)	636	WP_011677171.1	DUF421 domain-containing protein	-
JG741_RS09415 (LLG32_19420)	-	1857015..1859246 (+)	2232	WP_061777877.1	PBP1A family penicillin-binding protein	-
JG741_RS09420 (LLG32_19430)	-	1859348..1861165 (+)	1818	WP_126354658.1	acyltransferase family protein	-
JG741_RS09425 (LLG32_19440)	rpmG	1861206..1861355 (+)	150	WP_011677168.1	50S ribosomal protein L33	-
JG741_RS09430 (LLG32_19450)	secE	1861467..1861661 (+)	195	WP_011677167.1	preprotein translocase subunit SecE	-

Sequence

Protein

• Length: 62 a.a.
• Molecular weight: 7336.65 Da
• Isoelectric Point: 8.3463

>NTDB_id=84114 JG741_RS14345 WP_014573336.1 1848195..1848383(+) (comGD) [Lactococcus cremoris strain G3-2]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN

Nucleotide

• Length: 189 bp

>NTDB_id=84114 JG741_RS14345 WP_014573336.1 1848195..1848383(+) (comGD) [Lactococcus cremoris strain G3-2]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Lactococcus lactis subsp. cremoris KW2	93.548	100	0.935
comYD	Streptococcus mutans UA140	43.396	85.484	0.371
comYD	Streptococcus mutans UA159	43.396	85.484	0.371