Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QQF37_RS13785 Genome accession   NZ_CP126986
Coordinates   2837060..2837200 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MC2S-6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2832060..2842200
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQF37_RS13760 (QQF37_13760) - 2832406..2832789 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  QQF37_RS13765 (QQF37_13765) comA 2832811..2833455 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QQF37_RS13770 (QQF37_13770) comP 2833536..2835836 (-) 2301 WP_032876801.1 histidine kinase Regulator
  QQF37_RS13775 (QQF37_13775) comX 2835850..2836023 (-) 174 WP_012118314.1 competence pheromone ComX -
  QQF37_RS13780 (QQF37_13780) - 2835992..2836852 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  QQF37_RS13785 (QQF37_13785) degQ 2837060..2837200 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QQF37_RS13790 (QQF37_13790) - 2837666..2838007 (+) 342 WP_032876795.1 hypothetical protein -
  QQF37_RS13795 (QQF37_13795) - 2838014..2839237 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  QQF37_RS13800 (QQF37_13800) - 2839367..2840833 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  QQF37_RS13805 (QQF37_13805) - 2840851..2841402 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  QQF37_RS13810 (QQF37_13810) - 2841499..2841897 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=841073 QQF37_RS13785 WP_003152043.1 2837060..2837200(-) (degQ) [Bacillus velezensis strain MC2S-6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=841073 QQF37_RS13785 WP_003152043.1 2837060..2837200(-) (degQ) [Bacillus velezensis strain MC2S-6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891