Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   VKP53_RS07040 Genome accession   NZ_CP142354
Coordinates   1419796..1420014 (-) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 6745-99     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1414796..1425014
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP53_RS07010 (VKP53_07010) - 1415506..1415823 (-) 318 WP_002994587.1 hypothetical protein -
  VKP53_RS07015 (VKP53_07015) - 1415872..1416099 (-) 228 WP_028797129.1 Blp family class II bacteriocin -
  VKP53_RS07020 (VKP53_07020) - 1416497..1416625 (-) 129 WP_002994583.1 hypothetical protein -
  VKP53_RS09065 - 1416710..1416985 (-) 276 Protein_1333 lysostaphin resistance A-like protein -
  VKP53_RS07025 (VKP53_07025) - 1417317..1417493 (-) 177 WP_002994581.1 hypothetical protein -
  VKP53_RS07030 (VKP53_07030) - 1417471..1417695 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  VKP53_RS07035 (VKP53_07035) - 1417993..1419599 (+) 1607 Protein_1336 ABC transporter transmembrane domain-containing protein -
  VKP53_RS07040 (VKP53_07040) comE/blpR 1419796..1420014 (-) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  VKP53_RS07045 (VKP53_07045) - 1420315..1420569 (+) 255 WP_011106868.1 hypothetical protein -
  VKP53_RS07050 (VKP53_07050) - 1420875..1421351 (-) 477 WP_002985741.1 NUDIX hydrolase -
  VKP53_RS07055 (VKP53_07055) era 1421371..1422267 (-) 897 WP_110407831.1 GTPase Era -
  VKP53_RS07060 (VKP53_07060) - 1422387..1422794 (-) 408 WP_002985746.1 diacylglycerol kinase family protein -
  VKP53_RS07065 (VKP53_07065) ybeY 1422775..1423272 (-) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  VKP53_RS07070 (VKP53_07070) - 1423431..1424006 (-) 576 WP_136133459.1 uracil-DNA glycosylase family protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=840538 VKP53_RS07040 WP_072135532.1 1419796..1420014(-) (comE/blpR) [Streptococcus pyogenes strain 6745-99]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=840538 VKP53_RS07040 WP_072135532.1 1419796..1420014(-) (comE/blpR) [Streptococcus pyogenes strain 6745-99]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417