Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   VKP38_RS07195 Genome accession   NZ_CP142352
Coordinates   1433930..1434148 (-) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 2907-97     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1428930..1439148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP38_RS07165 (VKP38_07165) - 1429642..1429959 (-) 318 WP_002994587.1 hypothetical protein -
  VKP38_RS07170 (VKP38_07170) - 1430008..1430235 (-) 228 WP_028797129.1 Blp family class II bacteriocin -
  VKP38_RS07175 (VKP38_07175) - 1430633..1430761 (-) 129 WP_002994583.1 hypothetical protein -
  VKP38_RS09270 - 1430846..1431130 (-) 285 WP_079891230.1 CPBP family intramembrane glutamic endopeptidase -
  VKP38_RS07180 (VKP38_07180) - 1431451..1431627 (-) 177 WP_002994581.1 hypothetical protein -
  VKP38_RS07185 (VKP38_07185) - 1431605..1431829 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  VKP38_RS07190 (VKP38_07190) - 1432127..1433733 (+) 1607 Protein_1366 ABC transporter transmembrane domain-containing protein -
  VKP38_RS07195 (VKP38_07195) comE/blpR 1433930..1434148 (-) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  VKP38_RS07200 (VKP38_07200) - 1434438..1434692 (+) 255 WP_014407373.1 hypothetical protein -
  VKP38_RS07205 (VKP38_07205) - 1434998..1435474 (-) 477 WP_002993018.1 NUDIX hydrolase -
  VKP38_RS07210 (VKP38_07210) era 1435495..1436391 (-) 897 WP_002985743.1 GTPase Era -
  VKP38_RS07215 (VKP38_07215) - 1436511..1436918 (-) 408 WP_002985746.1 diacylglycerol kinase family protein -
  VKP38_RS07220 (VKP38_07220) ybeY 1436899..1437396 (-) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  VKP38_RS07225 (VKP38_07225) - 1437555..1438130 (-) 576 WP_009880369.1 uracil-DNA glycosylase family protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=840345 VKP38_RS07195 WP_072135532.1 1433930..1434148(-) (comE/blpR) [Streptococcus pyogenes strain 2907-97]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=840345 VKP38_RS07195 WP_072135532.1 1433930..1434148(-) (comE/blpR) [Streptococcus pyogenes strain 2907-97]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417