Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QPX68_RS11690 Genome accession   NZ_CP126696
Coordinates   2440027..2440341 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain GZY63     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435027..2445341
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPX68_RS11645 sinI 2435708..2435881 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  QPX68_RS11650 sinR 2435915..2436250 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QPX68_RS11655 - 2436298..2437083 (-) 786 WP_032874027.1 TasA family protein -
  QPX68_RS11660 - 2437148..2437732 (-) 585 WP_032874025.1 signal peptidase I -
  QPX68_RS11665 tapA 2437704..2438375 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  QPX68_RS11670 - 2438634..2438963 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  QPX68_RS11675 - 2439004..2439183 (-) 180 WP_022552966.1 YqzE family protein -
  QPX68_RS11680 comGG 2439240..2439617 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  QPX68_RS11685 comGF 2439618..2440118 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  QPX68_RS11690 comGE 2440027..2440341 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  QPX68_RS11695 comGD 2440325..2440762 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QPX68_RS11700 comGC 2440752..2441060 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QPX68_RS11705 comGB 2441065..2442102 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  QPX68_RS11710 comGA 2442089..2443159 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QPX68_RS11715 - 2443356..2444306 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=839574 QPX68_RS11690 WP_032874016.1 2440027..2440341(-) (comGE) [Bacillus amyloliquefaciens strain GZY63]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=839574 QPX68_RS11690 WP_032874016.1 2440027..2440341(-) (comGE) [Bacillus amyloliquefaciens strain GZY63]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481