Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   VDS58_RS13750 Genome accession   NZ_CP141997
Coordinates   2527348..2527521 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PM0031     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2522348..2532521
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VDS58_RS13735 (VDS58_13735) gcvT 2523146..2524234 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  VDS58_RS13740 (VDS58_13740) hepAA 2524676..2526349 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  VDS58_RS13745 (VDS58_13745) yqhG 2526370..2527164 (+) 795 WP_032726154.1 YqhG family protein -
  VDS58_RS13750 (VDS58_13750) sinI 2527348..2527521 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  VDS58_RS13755 (VDS58_13755) sinR 2527555..2527890 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  VDS58_RS13760 (VDS58_13760) tasA 2527982..2528767 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  VDS58_RS13765 (VDS58_13765) sipW 2528832..2529404 (-) 573 WP_003246088.1 signal peptidase I SipW -
  VDS58_RS13770 (VDS58_13770) tapA 2529388..2530149 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  VDS58_RS13775 (VDS58_13775) yqzG 2530420..2530746 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  VDS58_RS13780 (VDS58_13780) spoIITA 2530788..2530967 (-) 180 WP_014480252.1 YqzE family protein -
  VDS58_RS13785 (VDS58_13785) comGG 2531039..2531413 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  VDS58_RS13790 (VDS58_13790) comGF 2531414..2531797 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  VDS58_RS13795 (VDS58_13795) comGE 2531823..2532170 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=838941 VDS58_RS13750 WP_014477323.1 2527348..2527521(+) (sinI) [Bacillus subtilis strain PM0031]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=838941 VDS58_RS13750 WP_014477323.1 2527348..2527521(+) (sinI) [Bacillus subtilis strain PM0031]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982