Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   QPK28_RS18910 Genome accession   NZ_CP126576
Coordinates   3567954..3568238 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain CQMB003     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3519199..3569622 3567954..3568238 within 0


Gene organization within MGE regions


Location: 3519199..3569622
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPK28_RS18595 - 3519199..3519417 (-) 219 WP_011198294.1 transcriptional regulator -
  QPK28_RS18600 - 3519638..3520450 (+) 813 WP_075223314.1 hypothetical protein -
  QPK28_RS18605 - 3520540..3520908 (+) 369 WP_080618531.1 YolD-like family protein -
  QPK28_RS18610 - 3521131..3522252 (-) 1122 WP_071583847.1 Rap family tetratricopeptide repeat protein -
  QPK28_RS18615 - 3522508..3523845 (+) 1338 WP_348652123.1 T7SS effector LXG polymorphic toxin -
  QPK28_RS22445 - 3523770..3523955 (+) 186 WP_348652124.1 polymorphic toxin type 50 domain-containing protein -
  QPK28_RS18620 - 3523973..3524308 (+) 336 WP_016886588.1 hypothetical protein -
  QPK28_RS18625 - 3524409..3525362 (-) 954 WP_065644215.1 glycoside hydrolase family 25 protein -
  QPK28_RS18630 - 3525410..3525673 (-) 264 WP_080618532.1 phage holin -
  QPK28_RS18635 - 3525689..3525958 (-) 270 WP_009327757.1 hemolysin XhlA family protein -
  QPK28_RS18640 - 3526021..3526206 (-) 186 WP_003185324.1 XkdX family protein -
  QPK28_RS18645 - 3526203..3526526 (-) 324 WP_003185326.1 bZIP transcription factor -
  QPK28_RS18650 - 3526539..3527882 (-) 1344 WP_173636660.1 phage baseplate upper protein -
  QPK28_RS18655 - 3527896..3530541 (-) 2646 WP_048350599.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  QPK28_RS18660 - 3530577..3532289 (-) 1713 WP_140991832.1 phage tail protein -
  QPK28_RS18665 - 3532302..3533138 (-) 837 WP_017474879.1 phage tail family protein -
  QPK28_RS18670 - 3533138..3537607 (-) 4470 WP_017474880.1 phage tail tape measure protein -
  QPK28_RS18675 - 3537816..3538178 (-) 363 WP_003185339.1 hypothetical protein -
  QPK28_RS18680 - 3538232..3538849 (-) 618 WP_003185341.1 major tail protein -
  QPK28_RS18685 - 3538864..3539247 (-) 384 WP_003185344.1 hypothetical protein -
  QPK28_RS18690 - 3539244..3539642 (-) 399 WP_006637249.1 HK97-gp10 family putative phage morphogenesis protein -
  QPK28_RS18695 - 3539642..3539950 (-) 309 WP_003185349.1 phage head closure protein -
  QPK28_RS18700 - 3539940..3540242 (-) 303 WP_003185351.1 head-tail connector protein -
  QPK28_RS18705 - 3540263..3540688 (-) 426 WP_003185353.1 collagen-like protein -
  QPK28_RS18710 - 3540712..3541995 (-) 1284 WP_025807602.1 phage major capsid protein -
  QPK28_RS18715 - 3542034..3542765 (-) 732 WP_035317290.1 head maturation protease, ClpP-related -
  QPK28_RS18720 - 3542710..3544020 (-) 1311 WP_003185359.1 phage portal protein -
  QPK28_RS18725 - 3544021..3544212 (-) 192 WP_003185361.1 DUF1056 family protein -
  QPK28_RS18730 - 3544224..3545933 (-) 1710 WP_003185362.1 terminase TerL endonuclease subunit -
  QPK28_RS18735 - 3545930..3546445 (-) 516 WP_003185364.1 phage terminase small subunit P27 family -
  QPK28_RS18740 - 3546675..3547049 (-) 375 WP_021837717.1 HNH endonuclease -
  QPK28_RS18745 - 3547076..3547390 (-) 315 WP_021837718.1 hypothetical protein -
  QPK28_RS18750 - 3547377..3547937 (-) 561 WP_021837719.1 hypothetical protein -
  QPK28_RS18755 - 3548135..3548362 (-) 228 WP_006637236.1 hypothetical protein -
  QPK28_RS18760 cotD 3548579..3548803 (-) 225 WP_006637235.1 spore coat protein CotD -
  QPK28_RS18765 - 3549553..3549933 (-) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  QPK28_RS18770 - 3550046..3550423 (-) 378 WP_021837723.1 YopX family protein -
  QPK28_RS18775 - 3550439..3550954 (-) 516 WP_021837724.1 putative metallopeptidase -
  QPK28_RS18780 - 3550957..3551127 (-) 171 WP_071583658.1 Fur-regulated basic protein FbpA -
  QPK28_RS18785 - 3551124..3551663 (-) 540 WP_059260922.1 ERCC4 domain-containing protein -
  QPK28_RS18790 - 3551660..3552097 (-) 438 WP_021837727.1 hypothetical protein -
  QPK28_RS18795 - 3552075..3552446 (-) 372 WP_021837728.1 hypothetical protein -
  QPK28_RS18800 - 3552667..3555099 (-) 2433 WP_080618534.1 phage/plasmid primase, P4 family -
  QPK28_RS18805 - 3555160..3555597 (-) 438 WP_095266839.1 DUF669 domain-containing protein -
  QPK28_RS18810 - 3555597..3556529 (-) 933 WP_011198320.1 AAA family ATPase -
  QPK28_RS18815 - 3556533..3557090 (-) 558 WP_021837730.1 host-nuclease inhibitor Gam family protein -
  QPK28_RS18820 - 3557183..3557425 (-) 243 WP_011198322.1 hypothetical protein -
  QPK28_RS18825 - 3557513..3557779 (-) 267 WP_021837731.1 YqaH family protein -
  QPK28_RS18830 - 3557842..3558171 (+) 330 WP_021837732.1 hypothetical protein -
  QPK28_RS18835 - 3558168..3558326 (-) 159 WP_021837733.1 hypothetical protein -
  QPK28_RS18840 - 3558452..3559006 (-) 555 WP_003185401.1 hypothetical protein -
  QPK28_RS18845 - 3559064..3559252 (-) 189 WP_016886536.1 hypothetical protein -
  QPK28_RS18850 - 3559384..3559572 (-) 189 WP_003185403.1 helix-turn-helix domain-containing protein -
  QPK28_RS18855 - 3559569..3560363 (-) 795 WP_003185404.1 ORF6N domain-containing protein -
  QPK28_RS18860 - 3560425..3560742 (+) 318 WP_016886534.1 hypothetical protein -
  QPK28_RS18865 - 3560705..3560974 (-) 270 WP_016886533.1 hypothetical protein -
  QPK28_RS18870 - 3560989..3561228 (-) 240 WP_044789338.1 helix-turn-helix transcriptional regulator -
  QPK28_RS18875 - 3561385..3562035 (+) 651 WP_229118222.1 LexA family transcriptional regulator -
  QPK28_RS18880 - 3562106..3563200 (+) 1095 WP_003185410.1 site-specific integrase -
  QPK28_RS18890 smpB 3563764..3564237 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  QPK28_RS18895 rnr 3564349..3566652 (-) 2304 WP_003185414.1 ribonuclease R -
  QPK28_RS18900 - 3566666..3567412 (-) 747 WP_003185416.1 carboxylesterase -
  QPK28_RS18905 secG 3567553..3567783 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  QPK28_RS18910 abrB 3567954..3568238 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  QPK28_RS18915 - 3568267..3568500 (-) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  QPK28_RS18920 - 3568653..3569054 (+) 402 WP_009329609.1 transcriptional regulator -
  QPK28_RS18925 - 3569224..3569622 (+) 399 WP_009329610.1 helix-turn-helix transcriptional regulator -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=838820 QPK28_RS18910 WP_003185421.1 3567954..3568238(-) (abrB) [Bacillus licheniformis strain CQMB003]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=838820 QPK28_RS18910 WP_003185421.1 3567954..3568238(-) (abrB) [Bacillus licheniformis strain CQMB003]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543