Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QPK28_RS13945 Genome accession   NZ_CP126576
Coordinates   2642882..2643058 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain CQMB003     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2637882..2648058
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPK28_RS13930 gcvT 2638524..2639618 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  QPK28_RS13935 - 2640211..2641890 (+) 1680 WP_003183439.1 SNF2-related protein -
  QPK28_RS13940 - 2641897..2642691 (+) 795 WP_003183441.1 YqhG family protein -
  QPK28_RS13945 sinI 2642882..2643058 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  QPK28_RS13950 sinR 2643092..2643427 (+) 336 WP_025804940.1 helix-turn-helix domain-containing protein Regulator
  QPK28_RS13955 - 2643532..2644326 (-) 795 WP_003183447.1 TasA family protein -
  QPK28_RS13960 - 2644400..2644984 (-) 585 WP_003183449.1 signal peptidase I -
  QPK28_RS13965 tapA 2644981..2645709 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  QPK28_RS13970 - 2646019..2646306 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  QPK28_RS13975 - 2646330..2646512 (-) 183 WP_003183456.1 YqzE family protein -
  QPK28_RS13980 comGG 2646601..2646966 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  QPK28_RS13985 comGF 2646979..2647467 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  QPK28_RS13990 comGE 2647376..2647723 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=838801 QPK28_RS13945 WP_003183444.1 2642882..2643058(+) (sinI) [Bacillus licheniformis strain CQMB003]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=838801 QPK28_RS13945 WP_003183444.1 2642882..2643058(+) (sinI) [Bacillus licheniformis strain CQMB003]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517