Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QN218_RS02390 Genome accession   NZ_CP126534
Coordinates   485123..485263 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain BSY82     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 480123..490263
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QN218_RS02360 - 480418..480816 (+) 399 WP_019259337.1 YueI family protein -
  QN218_RS02365 - 480913..481464 (+) 552 WP_060399392.1 isochorismatase family cysteine hydrolase -
  QN218_RS02370 - 481480..482952 (+) 1473 WP_060399391.1 nicotinate phosphoribosyltransferase -
  QN218_RS02375 pdeH 483090..484319 (+) 1230 WP_060399390.1 cyclic di-GMP phosphodiesterase -
  QN218_RS02380 - 484295..484663 (-) 369 WP_003241042.1 hypothetical protein -
  QN218_RS02385 - 484776..484943 (-) 168 WP_119914210.1 hypothetical protein -
  QN218_RS02390 degQ 485123..485263 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QN218_RS02395 - 485448..486308 (+) 861 WP_032732270.1 polyprenyl synthetase family protein -
  QN218_RS02400 comX 486323..486484 (+) 162 WP_003241045.1 competence pheromone ComX -
  QN218_RS02405 comP 486492..488789 (+) 2298 WP_060399389.1 histidine kinase Regulator
  QN218_RS02410 comA 488870..489514 (+) 645 WP_104010190.1 two-component system response regulator ComA Regulator
  QN218_RS02415 - 489533..489913 (+) 381 WP_019259331.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=838531 QN218_RS02390 WP_003220708.1 485123..485263(+) (degQ) [Bacillus inaquosorum strain BSY82]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=838531 QN218_RS02390 WP_003220708.1 485123..485263(+) (degQ) [Bacillus inaquosorum strain BSY82]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1