Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | QPL83_RS04170 | Genome accession | NZ_CP126524 |
| Coordinates | 488049..488327 (+) | Length | 92 a.a. |
| NCBI ID | WP_284555668.1 | Uniprot ID | - |
| Organism | Bacillus toyonensis strain Monterrey_S3 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 478066..519035 | 488049..488327 | within | 0 |
Gene organization within MGE regions
Location: 478066..519035
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL83_RS04085 (QPL83_04085) | - | 478066..479190 (-) | 1125 | WP_284555654.1 | site-specific integrase | - |
| QPL83_RS04090 (QPL83_04090) | - | 479625..480308 (+) | 684 | WP_284555655.1 | hypothetical protein | - |
| QPL83_RS04095 (QPL83_04095) | - | 480336..480593 (+) | 258 | WP_284555656.1 | hypothetical protein | - |
| QPL83_RS04100 (QPL83_04100) | - | 480590..481036 (+) | 447 | WP_284555657.1 | protein-export chaperone SecB | - |
| QPL83_RS04105 (QPL83_04105) | - | 481396..481749 (-) | 354 | WP_284555658.1 | helix-turn-helix transcriptional regulator | - |
| QPL83_RS04110 (QPL83_04110) | - | 482253..483392 (+) | 1140 | WP_284555659.1 | AimR family lysis-lysogeny pheromone receptor | - |
| QPL83_RS04115 (QPL83_04115) | - | 483395..483538 (+) | 144 | WP_284555660.1 | hypothetical protein | - |
| QPL83_RS04120 (QPL83_04120) | - | 483683..483865 (+) | 183 | WP_098923091.1 | hypothetical protein | - |
| QPL83_RS04125 (QPL83_04125) | - | 483876..484223 (-) | 348 | WP_098923093.1 | helix-turn-helix transcriptional regulator | - |
| QPL83_RS04130 (QPL83_04130) | - | 484389..484661 (+) | 273 | WP_284555661.1 | helix-turn-helix transcriptional regulator | - |
| QPL83_RS04135 (QPL83_04135) | - | 484624..485355 (+) | 732 | WP_284555663.1 | ORF6C domain-containing protein | - |
| QPL83_RS04140 (QPL83_04140) | - | 485399..485749 (+) | 351 | WP_284555664.1 | helix-turn-helix domain-containing protein | - |
| QPL83_RS04145 (QPL83_04145) | - | 485746..485913 (+) | 168 | WP_284555976.1 | hypothetical protein | - |
| QPL83_RS04150 (QPL83_04150) | - | 485943..486128 (+) | 186 | WP_030026738.1 | hypothetical protein | - |
| QPL83_RS04155 (QPL83_04155) | - | 486125..487009 (+) | 885 | WP_284555665.1 | DnaD domain protein | - |
| QPL83_RS04160 (QPL83_04160) | - | 486948..487823 (+) | 876 | WP_284555666.1 | ATP-binding protein | - |
| QPL83_RS04165 (QPL83_04165) | - | 487839..488033 (+) | 195 | WP_284555667.1 | hypothetical protein | - |
| QPL83_RS04170 (QPL83_04170) | abrB | 488049..488327 (+) | 279 | WP_284555668.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| QPL83_RS04175 (QPL83_04175) | - | 488320..488679 (+) | 360 | WP_001125955.1 | hypothetical protein | - |
| QPL83_RS04180 (QPL83_04180) | - | 488698..488865 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| QPL83_RS04185 (QPL83_04185) | - | 488891..489364 (+) | 474 | WP_098188546.1 | sugar ABC transporter substrate-binding protein | - |
| QPL83_RS04190 (QPL83_04190) | - | 489391..489846 (+) | 456 | WP_284555669.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| QPL83_RS04195 (QPL83_04195) | - | 489885..490034 (+) | 150 | WP_284555670.1 | hypothetical protein | - |
| QPL83_RS04200 (QPL83_04200) | - | 490070..490420 (+) | 351 | WP_284555671.1 | hypothetical protein | - |
| QPL83_RS04205 (QPL83_04205) | - | 490457..490972 (+) | 516 | WP_284555673.1 | hypothetical protein | - |
| QPL83_RS04210 (QPL83_04210) | - | 491008..491382 (+) | 375 | WP_284555674.1 | hypothetical protein | - |
| QPL83_RS04215 (QPL83_04215) | dcm | 491479..492345 (+) | 867 | WP_257140106.1 | DNA (cytosine-5-)-methyltransferase | - |
| QPL83_RS04220 (QPL83_04220) | - | 492379..492570 (+) | 192 | WP_097880590.1 | hypothetical protein | - |
| QPL83_RS04225 (QPL83_04225) | - | 492673..492843 (+) | 171 | WP_284555675.1 | hypothetical protein | - |
| QPL83_RS04230 (QPL83_04230) | - | 492871..493353 (+) | 483 | WP_284555676.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QPL83_RS04235 (QPL83_04235) | - | 493353..493895 (+) | 543 | WP_070189700.1 | site-specific integrase | - |
| QPL83_RS04240 (QPL83_04240) | - | 494091..495044 (+) | 954 | WP_284555677.1 | hypothetical protein | - |
| QPL83_RS04245 (QPL83_04245) | - | 495476..495706 (+) | 231 | WP_087949881.1 | YjcQ family protein | - |
| QPL83_RS04250 (QPL83_04250) | - | 495759..496019 (+) | 261 | WP_087949880.1 | hypothetical protein | - |
| QPL83_RS04255 (QPL83_04255) | - | 496033..496296 (+) | 264 | WP_284555679.1 | hydrolase | - |
| QPL83_RS04260 (QPL83_04260) | - | 496316..496645 (+) | 330 | WP_215712248.1 | hypothetical protein | - |
| QPL83_RS04265 (QPL83_04265) | - | 496636..496878 (+) | 243 | WP_087949877.1 | hypothetical protein | - |
| QPL83_RS04270 (QPL83_04270) | - | 496865..497200 (+) | 336 | WP_284555682.1 | HNH endonuclease signature motif containing protein | - |
| QPL83_RS04275 (QPL83_04275) | - | 497325..497636 (+) | 312 | WP_012261558.1 | P27 family phage terminase small subunit | - |
| QPL83_RS04280 (QPL83_04280) | - | 497633..499300 (+) | 1668 | WP_097883014.1 | terminase TerL endonuclease subunit | - |
| QPL83_RS04285 (QPL83_04285) | - | 499309..500454 (+) | 1146 | WP_284555684.1 | phage portal protein | - |
| QPL83_RS04290 (QPL83_04290) | - | 500454..501194 (+) | 741 | WP_284555685.1 | head maturation protease, ClpP-related | - |
| QPL83_RS04295 (QPL83_04295) | - | 501198..502349 (+) | 1152 | WP_097883022.1 | phage major capsid protein | - |
| QPL83_RS04300 (QPL83_04300) | - | 502355..502648 (+) | 294 | WP_284555687.1 | hypothetical protein | - |
| QPL83_RS04305 (QPL83_04305) | - | 502650..503015 (+) | 366 | WP_098801418.1 | phage head closure protein | - |
| QPL83_RS04310 (QPL83_04310) | - | 503017..503361 (+) | 345 | WP_098801419.1 | HK97 gp10 family phage protein | - |
| QPL83_RS04315 (QPL83_04315) | - | 503358..503687 (+) | 330 | WP_097882692.1 | hypothetical protein | - |
| QPL83_RS04320 (QPL83_04320) | - | 503688..504284 (+) | 597 | WP_097882690.1 | major tail protein | - |
| QPL83_RS04325 (QPL83_04325) | - | 504291..504653 (+) | 363 | WP_097882687.1 | hypothetical protein | - |
| QPL83_RS04330 (QPL83_04330) | - | 504885..508505 (+) | 3621 | WP_284555688.1 | DUF2207 domain-containing protein | - |
| QPL83_RS04335 (QPL83_04335) | - | 508546..510003 (+) | 1458 | WP_284555689.1 | distal tail protein Dit | - |
| QPL83_RS04340 (QPL83_04340) | - | 510000..514598 (+) | 4599 | WP_284555690.1 | phage tail spike protein | - |
| QPL83_RS04345 (QPL83_04345) | - | 514613..515011 (+) | 399 | WP_098886256.1 | hypothetical protein | - |
| QPL83_RS04350 (QPL83_04350) | - | 515134..515370 (+) | 237 | WP_134996052.1 | hemolysin XhlA family protein | - |
| QPL83_RS04355 (QPL83_04355) | - | 515370..515609 (+) | 240 | WP_000461731.1 | hypothetical protein | - |
| QPL83_RS04360 (QPL83_04360) | - | 515606..516670 (+) | 1065 | WP_284555691.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QPL83_RS04365 (QPL83_04365) | - | 516726..517193 (-) | 468 | WP_284555693.1 | DUF2691 family protein | - |
| QPL83_RS04370 (QPL83_04370) | - | 517326..519035 (+) | 1710 | WP_284555694.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10095.67 Da Isoelectric Point: 7.2804
>NTDB_id=838354 QPL83_RS04170 WP_284555668.1 488049..488327(+) (abrB) [Bacillus toyonensis strain Monterrey_S3]
MKNTGVARKVDELGRVVIPVELRRSLGIAEGTALGFHVEGENIILRKHEKSCLVTGKVSESNIELLDGRMFLSREGASEL
LDILQKSEKAHA
MKNTGVARKVDELGRVVIPVELRRSLGIAEGTALGFHVEGENIILRKHEKSCLVTGKVSESNIELLDGRMFLSREGASEL
LDILQKSEKAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=838354 QPL83_RS04170 WP_284555668.1 488049..488327(+) (abrB) [Bacillus toyonensis strain Monterrey_S3]
ATGAAAAACACAGGTGTCGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAAGTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATCATTTTAAGAAAACATGAAAAGTCATGCTTAG
TAACGGGTAAAGTTTCCGAATCAAACATAGAATTGCTGGACGGACGAATGTTTTTGAGCAGGGAAGGCGCAAGTGAATTG
CTGGACATTCTTCAAAAGAGTGAGAAAGCTCATGCCTAA
ATGAAAAACACAGGTGTCGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAAGTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATCATTTTAAGAAAACATGAAAAGTCATGCTTAG
TAACGGGTAAAGTTTCCGAATCAAACATAGAATTGCTGGACGGACGAATGTTTTTGAGCAGGGAAGGCGCAAGTGAATTG
CTGGACATTCTTCAAAAGAGTGAGAAAGCTCATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
55.172 |
94.565 |
0.522 |