Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | QPL81_RS15055 | Genome accession | NZ_CP126520 |
| Coordinates | 2510272..2510550 (+) | Length | 92 a.a. |
| NCBI ID | WP_284557543.1 | Uniprot ID | - |
| Organism | Bacillus toyonensis strain Cuernavaca_S4 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2473864..2542377 | 2510272..2510550 | within | 0 |
Gene organization within MGE regions
Location: 2473864..2542377
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL81_RS14810 (QPL81_14810) | - | 2473864..2474187 (+) | 324 | WP_001032074.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| QPL81_RS14815 (QPL81_14815) | - | 2474343..2474615 (-) | 273 | WP_284557525.1 | ribose ABC transporter permease | - |
| QPL81_RS14820 (QPL81_14820) | - | 2475053..2475400 (-) | 348 | WP_000343263.1 | exosporium leader peptide-containing protein | - |
| QPL81_RS14825 (QPL81_14825) | - | 2476508..2476807 (-) | 300 | WP_079519334.1 | hypothetical protein | - |
| QPL81_RS14830 (QPL81_14830) | - | 2476888..2477109 (-) | 222 | WP_000807684.1 | hypothetical protein | - |
| QPL81_RS14835 (QPL81_14835) | - | 2477599..2478399 (+) | 801 | WP_000097507.1 | C1 family peptidase | - |
| QPL81_RS14840 (QPL81_14840) | - | 2478682..2478843 (+) | 162 | WP_000866207.1 | hypothetical protein | - |
| QPL81_RS14845 (QPL81_14845) | - | 2478871..2479353 (+) | 483 | WP_284557526.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QPL81_RS14850 (QPL81_14850) | - | 2479353..2479442 (+) | 90 | Protein_2404 | site-specific integrase | - |
| QPL81_RS14855 (QPL81_14855) | - | 2479633..2480856 (-) | 1224 | WP_284557527.1 | ATP-grasp domain-containing protein | - |
| QPL81_RS14860 (QPL81_14860) | - | 2480994..2482091 (+) | 1098 | WP_098069572.1 | YheC/YheD family protein | - |
| QPL81_RS14865 (QPL81_14865) | - | 2482363..2482893 (+) | 531 | WP_000429651.1 | hypothetical protein | - |
| QPL81_RS14870 (QPL81_14870) | - | 2483306..2483611 (-) | 306 | WP_000728142.1 | WGxxGxxG family protein | - |
| QPL81_RS14875 (QPL81_14875) | - | 2484254..2484421 (+) | 168 | WP_001293570.1 | hypothetical protein | - |
| QPL81_RS14880 (QPL81_14880) | - | 2484484..2484756 (+) | 273 | WP_284557528.1 | hydrolase | - |
| QPL81_RS14885 (QPL81_14885) | - | 2484735..2485205 (+) | 471 | WP_284557529.1 | ATP-binding protein | - |
| QPL81_RS14890 (QPL81_14890) | - | 2485401..2485595 (+) | 195 | WP_000332432.1 | hypothetical protein | - |
| QPL81_RS14895 (QPL81_14895) | - | 2485622..2485795 (+) | 174 | WP_000761511.1 | DUF3954 domain-containing protein | - |
| QPL81_RS14900 (QPL81_14900) | - | 2485810..2486064 (+) | 255 | WP_097855437.1 | hypothetical protein | - |
| QPL81_RS14905 (QPL81_14905) | - | 2486077..2486505 (+) | 429 | WP_097855436.1 | hypothetical protein | - |
| QPL81_RS14910 (QPL81_14910) | - | 2486521..2486985 (+) | 465 | WP_097855435.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| QPL81_RS14915 (QPL81_14915) | - | 2488598..2489329 (-) | 732 | WP_284557530.1 | glycosyltransferase family 2 protein | - |
| QPL81_RS14920 (QPL81_14920) | - | 2489615..2489899 (-) | 285 | WP_097887870.1 | DUF4183 domain-containing protein | - |
| QPL81_RS14925 (QPL81_14925) | - | 2490495..2490689 (+) | 195 | WP_097855426.1 | hypothetical protein | - |
| QPL81_RS14930 (QPL81_14930) | - | 2490958..2491185 (+) | 228 | WP_097855425.1 | hypothetical protein | - |
| QPL81_RS14935 (QPL81_14935) | - | 2491380..2491841 (+) | 462 | WP_284557531.1 | nucleoside 2-deoxyribosyltransferase | - |
| QPL81_RS14940 (QPL81_14940) | - | 2492221..2492703 (+) | 483 | WP_284557532.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QPL81_RS14945 (QPL81_14945) | - | 2492703..2493241 (+) | 539 | Protein_2423 | site-specific integrase | - |
| QPL81_RS14950 (QPL81_14950) | - | 2493356..2494495 (-) | 1140 | WP_131229164.1 | Ig-like domain-containing protein | - |
| QPL81_RS14955 (QPL81_14955) | - | 2495058..2495387 (-) | 330 | WP_000728240.1 | WGxxGxxG family protein | - |
| QPL81_RS14960 (QPL81_14960) | - | 2495734..2496249 (+) | 516 | WP_000512143.1 | DUF3231 family protein | - |
| QPL81_RS14965 (QPL81_14965) | - | 2496491..2496661 (+) | 171 | WP_000344287.1 | hypothetical protein | - |
| QPL81_RS14970 (QPL81_14970) | - | 2496894..2497229 (+) | 336 | WP_131229166.1 | HNH endonuclease | - |
| QPL81_RS14975 (QPL81_14975) | - | 2497382..2497716 (+) | 335 | Protein_2429 | P27 family phage terminase small subunit | - |
| QPL81_RS14980 (QPL81_14980) | - | 2497713..2498771 (+) | 1059 | WP_284557533.1 | terminase large subunit | - |
| QPL81_RS14985 (QPL81_14985) | - | 2498726..2499343 (+) | 618 | Protein_2431 | peptidoglycan recognition family protein | - |
| QPL81_RS14990 (QPL81_14990) | - | 2499385..2500248 (+) | 864 | WP_284557534.1 | exosporium leader peptide-containing protein | - |
| QPL81_RS29415 | - | 2500280..2500513 (+) | 234 | Protein_2433 | hypothetical protein | - |
| QPL81_RS14995 (QPL81_14995) | - | 2500746..2501249 (+) | 504 | WP_284557535.1 | hypothetical protein | - |
| QPL81_RS15000 (QPL81_15000) | - | 2502860..2503528 (+) | 669 | WP_080609389.1 | DUF3962 domain-containing protein | - |
| QPL81_RS15005 (QPL81_15005) | - | 2503597..2504706 (-) | 1110 | WP_284557536.1 | tyrosine-type recombinase/integrase | - |
| QPL81_RS15010 (QPL81_15010) | - | 2505358..2506524 (+) | 1167 | WP_087950324.1 | AimR family lysis-lysogeny pheromone receptor | - |
| QPL81_RS15015 (QPL81_15015) | - | 2506564..2506716 (+) | 153 | WP_284557537.1 | hypothetical protein | - |
| QPL81_RS15020 (QPL81_15020) | - | 2506870..2507019 (+) | 150 | WP_001031200.1 | hypothetical protein | - |
| QPL81_RS15025 (QPL81_15025) | - | 2507025..2507372 (-) | 348 | WP_087949909.1 | helix-turn-helix transcriptional regulator | - |
| QPL81_RS15030 (QPL81_15030) | - | 2507574..2507777 (+) | 204 | WP_000593825.1 | helix-turn-helix transcriptional regulator | - |
| QPL81_RS15035 (QPL81_15035) | - | 2507848..2508123 (+) | 276 | WP_284557538.1 | helix-turn-helix domain-containing protein | - |
| QPL81_RS15040 (QPL81_15040) | - | 2508526..2509254 (+) | 729 | WP_284557539.1 | DnaD domain protein | - |
| QPL81_RS15045 (QPL81_15045) | - | 2509196..2510059 (+) | 864 | WP_284557540.1 | ATP-binding protein | - |
| QPL81_RS15050 (QPL81_15050) | - | 2510062..2510256 (+) | 195 | WP_284557542.1 | hypothetical protein | - |
| QPL81_RS15055 (QPL81_15055) | abrB | 2510272..2510550 (+) | 279 | WP_284557543.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| QPL81_RS15060 (QPL81_15060) | - | 2510543..2510902 (+) | 360 | WP_284557544.1 | cell division protein SepF | - |
| QPL81_RS15065 (QPL81_15065) | - | 2510921..2511088 (+) | 168 | WP_078204465.1 | DUF3954 domain-containing protein | - |
| QPL81_RS15070 (QPL81_15070) | - | 2511116..2511589 (+) | 474 | WP_284557545.1 | sugar ABC transporter substrate-binding protein | - |
| QPL81_RS15075 (QPL81_15075) | - | 2511616..2512071 (+) | 456 | WP_284557546.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| QPL81_RS15080 (QPL81_15080) | - | 2512219..2512845 (-) | 627 | WP_284557547.1 | exosporium leader peptide-containing protein | - |
| QPL81_RS15085 (QPL81_15085) | - | 2513935..2515017 (+) | 1083 | WP_284557597.1 | glycosyltransferase | - |
| QPL81_RS15090 (QPL81_15090) | - | 2515766..2515936 (+) | 171 | WP_284557549.1 | hypothetical protein | - |
| QPL81_RS15095 (QPL81_15095) | - | 2515963..2516445 (+) | 483 | WP_284557550.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QPL81_RS15100 (QPL81_15100) | - | 2516445..2516987 (+) | 543 | WP_284557551.1 | site-specific integrase | - |
| QPL81_RS15105 (QPL81_15105) | - | 2517311..2518219 (+) | 909 | WP_284557552.1 | hypothetical protein | - |
| QPL81_RS15110 (QPL81_15110) | - | 2518232..2519566 (+) | 1335 | WP_284557553.1 | hypothetical protein | - |
| QPL81_RS15115 (QPL81_15115) | - | 2519913..2520254 (-) | 342 | WP_284557554.1 | hypothetical protein | - |
| QPL81_RS15120 (QPL81_15120) | - | 2520893..2521198 (+) | 306 | WP_284557555.1 | hypothetical protein | - |
| QPL81_RS15125 (QPL81_15125) | - | 2521672..2522070 (+) | 399 | WP_284557556.1 | hypothetical protein | - |
| QPL81_RS15130 (QPL81_15130) | - | 2522066..2522401 (+) | 336 | WP_284557598.1 | HNH endonuclease | - |
| QPL81_RS15135 (QPL81_15135) | - | 2522554..2522889 (+) | 336 | WP_098164100.1 | P27 family phage terminase small subunit | - |
| QPL81_RS15140 (QPL81_15140) | - | 2522886..2524544 (+) | 1659 | WP_284557557.1 | terminase TerL endonuclease subunit | - |
| QPL81_RS15145 (QPL81_15145) | - | 2524553..2525677 (+) | 1125 | WP_284557558.1 | phage portal protein | - |
| QPL81_RS15150 (QPL81_15150) | - | 2525700..2526482 (+) | 783 | WP_284557559.1 | head maturation protease, ClpP-related | - |
| QPL81_RS15155 (QPL81_15155) | - | 2526502..2527665 (+) | 1164 | WP_284557560.1 | phage major capsid protein | - |
| QPL81_RS15160 (QPL81_15160) | - | 2527678..2527974 (+) | 297 | WP_098188566.1 | hypothetical protein | - |
| QPL81_RS15165 (QPL81_15165) | - | 2527976..2528326 (+) | 351 | WP_098169563.1 | phage head closure protein | - |
| QPL81_RS15170 (QPL81_15170) | - | 2528328..2528672 (+) | 345 | WP_098188565.1 | HK97 gp10 family phage protein | - |
| QPL81_RS15175 (QPL81_15175) | - | 2528669..2528998 (+) | 330 | WP_284557561.1 | hypothetical protein | - |
| QPL81_RS15180 (QPL81_15180) | - | 2528999..2529595 (+) | 597 | WP_284557562.1 | major tail protein | - |
| QPL81_RS15185 (QPL81_15185) | - | 2529600..2529962 (+) | 363 | WP_284557563.1 | hypothetical protein | - |
| QPL81_RS15190 (QPL81_15190) | - | 2530194..2533814 (+) | 3621 | WP_284557564.1 | DUF2207 domain-containing protein | - |
| QPL81_RS15195 (QPL81_15195) | - | 2533855..2535312 (+) | 1458 | WP_284557565.1 | distal tail protein Dit | - |
| QPL81_RS15200 (QPL81_15200) | - | 2535309..2540306 (+) | 4998 | WP_284557566.1 | phage tail spike protein | - |
| QPL81_RS15205 (QPL81_15205) | - | 2540321..2540719 (+) | 399 | WP_284557567.1 | hypothetical protein | - |
| QPL81_RS15210 (QPL81_15210) | - | 2540841..2541077 (+) | 237 | WP_053446341.1 | hemolysin XhlA family protein | - |
| QPL81_RS15215 (QPL81_15215) | - | 2541077..2541316 (+) | 240 | WP_000461731.1 | hypothetical protein | - |
| QPL81_RS15220 (QPL81_15220) | - | 2541313..2542377 (+) | 1065 | WP_284557568.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 9938.52 Da Isoelectric Point: 7.1683
>NTDB_id=838262 QPL81_RS15055 WP_284557543.1 2510272..2510550(+) (abrB) [Bacillus toyonensis strain Cuernavaca_S4]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGEASESNMELLGGRMFLSKEGASKL
LDVIEKSGIVNA
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGEASESNMELLGGRMFLSKEGASKL
LDVIEKSGIVNA
Nucleotide
Download Length: 279 bp
>NTDB_id=838262 QPL81_RS15055 WP_284557543.1 2510272..2510550(+) (abrB) [Bacillus toyonensis strain Cuernavaca_S4]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCGGTTGAGTTACGCAGAACTTTAGG
GATTGCTGAGGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACATGAAAAATCATGCTTTG
TAACAGGTGAAGCTTCTGAATCAAACATGGAGTTGCTAGGCGGTCGGATGTTTTTAAGTAAGGAAGGCGCAAGTAAGTTG
TTGGACGTTATTGAGAAGAGTGGGATTGTAAATGCCTAA
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCGGTTGAGTTACGCAGAACTTTAGG
GATTGCTGAGGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACATGAAAAATCATGCTTTG
TAACAGGTGAAGCTTCTGAATCAAACATGGAGTTGCTAGGCGGTCGGATGTTTTTAAGTAAGGAAGGCGCAAGTAAGTTG
TTGGACGTTATTGAGAAGAGTGGGATTGTAAATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.471 |
94.565 |
0.543 |