Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QN340_RS21015 Genome accession   NZ_CP126496
Coordinates   4153169..4153309 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain DY4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 4148169..4158309
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QN340_RS20985 (QN340_20985) - 4149460..4149672 (-) 213 WP_040037657.1 hypothetical protein -
  QN340_RS20990 (QN340_20990) - 4149704..4150414 (-) 711 WP_020452313.1 GAP family protein -
  QN340_RS20995 (QN340_20995) - 4150503..4151096 (+) 594 WP_020452312.1 TetR/AcrR family transcriptional regulator -
  QN340_RS21000 (QN340_21000) - 4151090..4151800 (-) 711 WP_183163973.1 hypothetical protein -
  QN340_RS21005 (QN340_21005) comX 4151929..4152099 (-) 171 WP_020452790.1 competence pheromone ComX -
  QN340_RS21010 (QN340_21010) - 4152071..4152982 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  QN340_RS21015 (QN340_21015) degQ 4153169..4153309 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  QN340_RS21020 (QN340_21020) - 4153795..4154142 (+) 348 WP_223254849.1 hypothetical protein -
  QN340_RS21025 (QN340_21025) - 4154185..4155405 (-) 1221 WP_020452793.1 HDOD domain-containing protein -
  QN340_RS21030 (QN340_21030) - 4155583..4157052 (-) 1470 WP_020452794.1 nicotinate phosphoribosyltransferase -
  QN340_RS21035 (QN340_21035) - 4157070..4157621 (-) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  QN340_RS21040 (QN340_21040) - 4157807..4158208 (-) 402 WP_039072963.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=838184 QN340_RS21015 WP_003184860.1 4153169..4153309(-) (degQ) [Bacillus paralicheniformis strain DY4]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=838184 QN340_RS21015 WP_003184860.1 4153169..4153309(-) (degQ) [Bacillus paralicheniformis strain DY4]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652