Detailed information
Bioinformatically predicted
Overview
| Name | kre | Type | Regulator |
| Locus tag | QLQ03_RS15530 | Genome accession | NZ_CP126456 |
| Coordinates | 3026030..3026491 (-) | Length | 153 a.a. |
| NCBI ID | WP_007498684.1 | Uniprot ID | A0A9X0FXQ0 |
| Organism | Bacillus altitudinis strain KRS010 | ||
| Function | regulation of regulators (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3026657..3074392 | 3026030..3026491 | flank | 166 |
Gene organization within MGE regions
Location: 3026030..3074392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ03_RS15530 | kre | 3026030..3026491 (-) | 462 | WP_007498684.1 | YkyB family protein | Regulator |
| QLQ03_RS15535 | - | 3026657..3027814 (-) | 1158 | WP_284565035.1 | site-specific integrase | - |
| QLQ03_RS15540 | - | 3027859..3028332 (-) | 474 | WP_243173005.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ03_RS15545 | - | 3028345..3028650 (-) | 306 | WP_106032416.1 | helix-turn-helix transcriptional regulator | - |
| QLQ03_RS15550 | - | 3028921..3029121 (+) | 201 | WP_243173037.1 | helix-turn-helix domain-containing protein | - |
| QLQ03_RS15555 | - | 3029108..3029380 (+) | 273 | WP_243173006.1 | hypothetical protein | - |
| QLQ03_RS15560 | - | 3029528..3029695 (+) | 168 | WP_284565036.1 | hypothetical protein | - |
| QLQ03_RS15565 | - | 3029692..3029832 (+) | 141 | WP_284565037.1 | hypothetical protein | - |
| QLQ03_RS15570 | - | 3030000..3030236 (+) | 237 | WP_284565038.1 | hypothetical protein | - |
| QLQ03_RS15575 | - | 3030404..3030805 (+) | 402 | WP_144739507.1 | hypothetical protein | - |
| QLQ03_RS15580 | - | 3030817..3031605 (+) | 789 | WP_284565039.1 | Replication protein O | - |
| QLQ03_RS15585 | - | 3031598..3031957 (+) | 360 | WP_243173012.1 | replicative helicase loader/inhibitor | - |
| QLQ03_RS15590 | dnaB | 3031954..3033282 (+) | 1329 | WP_284565040.1 | replicative DNA helicase | - |
| QLQ03_RS15595 | - | 3033279..3033494 (+) | 216 | WP_284565041.1 | hypothetical protein | - |
| QLQ03_RS15600 | - | 3033491..3033649 (+) | 159 | WP_284565042.1 | BH0509 family protein | - |
| QLQ03_RS15605 | - | 3033646..3033981 (+) | 336 | WP_284565043.1 | hypothetical protein | - |
| QLQ03_RS15610 | - | 3034069..3034263 (+) | 195 | WP_243173016.1 | XtrA/YqaO family protein | - |
| QLQ03_RS15615 | - | 3034361..3034552 (+) | 192 | WP_284565044.1 | hypothetical protein | - |
| QLQ03_RS15620 | - | 3034567..3035070 (+) | 504 | WP_284565045.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| QLQ03_RS15625 | - | 3035060..3035494 (+) | 435 | WP_284565046.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ03_RS15630 | - | 3035575..3036165 (+) | 591 | WP_284565047.1 | hypothetical protein | - |
| QLQ03_RS15635 | - | 3036316..3036660 (+) | 345 | WP_061418874.1 | hypothetical protein | - |
| QLQ03_RS15640 | - | 3036970..3037350 (+) | 381 | WP_061418881.1 | hypothetical protein | - |
| QLQ03_RS15645 | - | 3037394..3038089 (+) | 696 | WP_061418884.1 | hypothetical protein | - |
| QLQ03_RS15650 | - | 3038304..3038792 (+) | 489 | WP_061418885.1 | phage terminase small subunit P27 family | - |
| QLQ03_RS15655 | - | 3038779..3040506 (+) | 1728 | WP_284565048.1 | terminase TerL endonuclease subunit | - |
| QLQ03_RS15660 | - | 3040521..3040721 (+) | 201 | WP_159159650.1 | hypothetical protein | - |
| QLQ03_RS15665 | - | 3040728..3041963 (+) | 1236 | WP_284565049.1 | phage portal protein | - |
| QLQ03_RS15670 | - | 3041941..3042531 (+) | 591 | WP_284565050.1 | HK97 family phage prohead protease | - |
| QLQ03_RS15675 | - | 3042585..3043766 (+) | 1182 | WP_113387283.1 | phage major capsid protein | - |
| QLQ03_RS15680 | - | 3043779..3044081 (+) | 303 | WP_212362272.1 | head-tail connector protein | - |
| QLQ03_RS15685 | - | 3044063..3044395 (+) | 333 | WP_284565051.1 | phage head closure protein | - |
| QLQ03_RS15690 | - | 3044395..3044778 (+) | 384 | WP_212362275.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ03_RS15695 | - | 3044775..3045167 (+) | 393 | WP_284565052.1 | hypothetical protein | - |
| QLQ03_RS15700 | - | 3045182..3045790 (+) | 609 | WP_284565053.1 | major tail protein | - |
| QLQ03_RS15705 | - | 3045865..3046188 (+) | 324 | WP_073206582.1 | hypothetical protein | - |
| QLQ03_RS15710 | - | 3046416..3050078 (+) | 3663 | WP_284565054.1 | phage tail tape measure protein | - |
| QLQ03_RS15715 | - | 3050075..3050902 (+) | 828 | WP_284565055.1 | phage tail domain-containing protein | - |
| QLQ03_RS15720 | - | 3050908..3052812 (+) | 1905 | WP_284565056.1 | phage tail protein | - |
| QLQ03_RS15725 | - | 3052854..3054758 (+) | 1905 | WP_284565057.1 | right-handed parallel beta-helix repeat-containing protein | - |
| QLQ03_RS15730 | - | 3054758..3055051 (+) | 294 | WP_250026803.1 | hypothetical protein | - |
| QLQ03_RS15735 | - | 3055032..3056678 (+) | 1647 | WP_284565058.1 | BppU family phage baseplate upper protein | - |
| QLQ03_RS15740 | - | 3056692..3056973 (+) | 282 | WP_144739456.1 | hypothetical protein | - |
| QLQ03_RS15745 | - | 3056970..3057110 (+) | 141 | WP_144739454.1 | XkdX family protein | - |
| QLQ03_RS15750 | - | 3057144..3057356 (+) | 213 | WP_073206560.1 | BhlA/UviB family holin-like peptide | - |
| QLQ03_RS15755 | - | 3057377..3057640 (+) | 264 | WP_212362293.1 | phage holin | - |
| QLQ03_RS15760 | - | 3057701..3058501 (+) | 801 | WP_284565059.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QLQ03_RS15765 | - | 3058783..3059202 (+) | 420 | WP_284565060.1 | hypothetical protein | - |
| QLQ03_RS15770 | - | 3059220..3059651 (+) | 432 | WP_284565061.1 | DUF1878 family protein | - |
| QLQ03_RS15775 | - | 3059762..3060895 (+) | 1134 | WP_061418948.1 | RapH N-terminal domain-containing protein | - |
| QLQ03_RS15780 | - | 3061050..3061241 (-) | 192 | WP_146270158.1 | hypothetical protein | - |
| QLQ03_RS15785 | - | 3062024..3062239 (-) | 216 | WP_058337408.1 | hypothetical protein | - |
| QLQ03_RS15790 | - | 3062407..3062583 (+) | 177 | WP_284565062.1 | hypothetical protein | - |
| QLQ03_RS15795 | - | 3062648..3063925 (-) | 1278 | WP_008348012.1 | MFS transporter | - |
| QLQ03_RS15800 | - | 3063999..3064496 (-) | 498 | WP_008348009.1 | L,D-transpeptidase family protein | - |
| QLQ03_RS15805 | - | 3064653..3065510 (-) | 858 | WP_039168707.1 | metallophosphoesterase | - |
| QLQ03_RS15810 | fadH | 3065650..3066414 (+) | 765 | WP_138278462.1 | 2,4-dienoyl-CoA reductase | - |
| QLQ03_RS15815 | - | 3066479..3067699 (+) | 1221 | WP_284565334.1 | EAL-associated domain-containing protein | - |
| QLQ03_RS15820 | - | 3067960..3068856 (+) | 897 | WP_007498675.1 | manganese catalase family protein | - |
| QLQ03_RS15825 | - | 3069041..3069283 (+) | 243 | WP_003212254.1 | DUF1797 family protein | - |
| QLQ03_RS15830 | - | 3069423..3069938 (+) | 516 | WP_008348001.1 | ribonuclease H-like YkuK family protein | - |
| QLQ03_RS15835 | abbA | 3070088..3070279 (+) | 192 | WP_008347999.1 | antirepressor AbbA | - |
| QLQ03_RS15840 | cbpB | 3070426..3070869 (+) | 444 | WP_007498671.1 | cyclic-di-AMP-binding protein CbpB | - |
| QLQ03_RS15845 | - | 3070966..3071847 (+) | 882 | WP_007498669.1 | LysR family transcriptional regulator | - |
| QLQ03_RS15850 | - | 3071951..3072358 (+) | 408 | WP_017367152.1 | DUF4275 family protein | - |
| QLQ03_RS15855 | - | 3072558..3073034 (+) | 477 | WP_017359419.1 | flavodoxin | - |
| QLQ03_RS15860 | - | 3073024..3073917 (+) | 894 | WP_242731929.1 | exo-alpha-sialidase | - |
| QLQ03_RS15865 | - | 3073967..3074392 (+) | 426 | WP_045034296.1 | flavodoxin | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 17739.31 Da Isoelectric Point: 10.2617
>NTDB_id=837925 QLQ03_RS15530 WP_007498684.1 3026030..3026491(-) (kre) [Bacillus altitudinis strain KRS010]
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGRKVGLHFSNNPRYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGRKVGLHFSNNPRYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF
Nucleotide
Download Length: 462 bp
>NTDB_id=837925 QLQ03_RS15530 WP_007498684.1 3026030..3026491(-) (kre) [Bacillus altitudinis strain KRS010]
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGCCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAGAAAAGTGGGCCTACATTTCTCTAACAATCCCAGATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCATCTGCCACCAACTAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCAAAAGCGAATATGTCATTAAATCGAGCGAAACAAATACTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACAAAACCCGTCTTCAAACGGCTCGGAGAAAGTTATTTTTAA
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGCCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAGAAAAGTGGGCCTACATTTCTCTAACAATCCCAGATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCATCTGCCACCAACTAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCAAAAGCGAATATGTCATTAAATCGAGCGAAACAAATACTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACAAAACCCGTCTTCAAACGGCTCGGAGAAAGTTATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| kre | Bacillus subtilis subsp. subtilis str. 168 |
76.623 |
100 |
0.771 |