Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   U7118_RS05315 Genome accession   NZ_CP141283
Coordinates   1020380..1020520 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DKU_09     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1015380..1025520
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U7118_RS05285 (U7118_05285) yueI 1015675..1016073 (+) 399 WP_014480710.1 YueI family protein -
  U7118_RS05290 (U7118_05290) pncA 1016170..1016721 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  U7118_RS05295 (U7118_05295) pncB 1016737..1018209 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  U7118_RS05300 (U7118_05300) pdeH 1018345..1019574 (+) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  U7118_RS05305 (U7118_05305) - 1019550..1019918 (-) 369 WP_046381300.1 hypothetical protein -
  U7118_RS05310 (U7118_05310) - 1020033..1020158 (-) 126 WP_003228793.1 hypothetical protein -
  U7118_RS05315 (U7118_05315) degQ 1020380..1020520 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  U7118_RS05320 (U7118_05320) comQ 1020705..1021568 (+) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  U7118_RS05325 (U7118_05325) comX 1021570..1021791 (+) 222 WP_014480704.1 competence pheromone ComX -
  U7118_RS05330 (U7118_05330) comP 1021807..1024119 (+) 2313 WP_103330147.1 sensor histidine kinase Regulator
  U7118_RS05335 (U7118_05335) comA 1024200..1024844 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  U7118_RS05340 (U7118_05340) yuxO 1024863..1025243 (+) 381 WP_069837723.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=836686 U7118_RS05315 WP_003220708.1 1020380..1020520(+) (degQ) [Bacillus subtilis strain DKU_09]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=836686 U7118_RS05315 WP_003220708.1 1020380..1020520(+) (degQ) [Bacillus subtilis strain DKU_09]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1