Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QNH31_RS12525 Genome accession   NZ_CP126094
Coordinates   2441708..2441881 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain G2S2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2436708..2446881
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH31_RS12510 (QNH31_12510) gcvT 2437508..2438596 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  QNH31_RS12515 (QNH31_12515) yqhH 2439037..2440710 (+) 1674 WP_041850014.1 SNF2-related protein -
  QNH31_RS12520 (QNH31_12520) yqhG 2440731..2441525 (+) 795 WP_003230200.1 YqhG family protein -
  QNH31_RS12525 (QNH31_12525) sinI 2441708..2441881 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNH31_RS12530 (QNH31_12530) sinR 2441915..2442250 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNH31_RS12535 (QNH31_12535) tasA 2442343..2443128 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  QNH31_RS12540 (QNH31_12540) sipW 2443192..2443764 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QNH31_RS12545 (QNH31_12545) tapA 2443748..2444509 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  QNH31_RS12550 (QNH31_12550) yqzG 2444781..2445107 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNH31_RS12555 (QNH31_12555) spoIIT 2445149..2445328 (-) 180 WP_003230176.1 YqzE family protein -
  QNH31_RS12560 (QNH31_12560) comGG 2445399..2445773 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  QNH31_RS12565 (QNH31_12565) comGF 2445774..2446157 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  QNH31_RS12570 (QNH31_12570) comGE 2446183..2446530 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=835542 QNH31_RS12525 WP_003230187.1 2441708..2441881(+) (sinI) [Bacillus subtilis strain G2S2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=835542 QNH31_RS12525 WP_003230187.1 2441708..2441881(+) (sinI) [Bacillus subtilis strain G2S2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1