Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   QNH50_RS21750 Genome accession   NZ_CP126092
Coordinates   4472928..4473284 (+) Length   118 a.a.
NCBI ID   WP_096340856.1    Uniprot ID   -
Organism   Peribacillus simplex strain D9_B_73     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 4454484..4481253 4472928..4473284 within 0


Gene organization within MGE regions


Location: 4454484..4481253
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH50_RS21645 (QNH50_21645) - 4455205..4455555 (-) 351 WP_230303925.1 hypothetical protein -
  QNH50_RS26300 - 4455960..4456199 (-) 240 WP_349654739.1 hypothetical protein -
  QNH50_RS21655 (QNH50_21655) - 4456565..4457797 (+) 1233 WP_230304281.1 IS110 family transposase -
  QNH50_RS21660 (QNH50_21660) - 4458585..4459046 (-) 462 WP_230303926.1 GNAT family N-acetyltransferase -
  QNH50_RS21665 (QNH50_21665) - 4459657..4460166 (-) 510 WP_230303927.1 MepB family protein -
  QNH50_RS21670 (QNH50_21670) dfr 4460313..4460804 (-) 492 WP_230303928.1 DfrD/DfrG/DfrK family trimethoprim-resistant dihydrofolate reductase -
  QNH50_RS21675 (QNH50_21675) - 4460956..4461369 (-) 414 WP_230303929.1 DUF2283 domain-containing protein -
  QNH50_RS21680 (QNH50_21680) - 4461534..4461956 (-) 423 WP_230303930.1 hypothetical protein -
  QNH50_RS21685 (QNH50_21685) - 4462183..4463352 (-) 1170 WP_283932180.1 serine hydrolase domain-containing protein -
  QNH50_RS21690 (QNH50_21690) - 4463748..4464431 (-) 684 WP_230303932.1 hypothetical protein -
  QNH50_RS21695 (QNH50_21695) - 4464881..4465069 (-) 189 WP_230303933.1 hypothetical protein -
  QNH50_RS21700 (QNH50_21700) - 4465215..4465391 (-) 177 WP_230303934.1 DUF4083 family protein -
  QNH50_RS21705 (QNH50_21705) - 4465608..4466432 (+) 825 WP_230303935.1 MBL fold metallo-hydrolase -
  QNH50_RS21710 (QNH50_21710) - 4466684..4466869 (-) 186 WP_230303936.1 hypothetical protein -
  QNH50_RS21715 (QNH50_21715) - 4467018..4467974 (+) 957 WP_230303937.1 patatin-like phospholipase family protein -
  QNH50_RS26305 - 4468178..4468399 (-) 222 WP_349654766.1 DUF3953 domain-containing protein -
  QNH50_RS21725 (QNH50_21725) - 4468766..4470001 (+) 1236 WP_283932181.1 IS110 family transposase -
  QNH50_RS21730 (QNH50_21730) - 4470702..4471082 (-) 381 WP_230304298.1 hypothetical protein -
  QNH50_RS21735 (QNH50_21735) - 4471490..4472059 (-) 570 WP_283933112.1 recombinase family protein -
  QNH50_RS21740 (QNH50_21740) - 4472180..4472437 (+) 258 WP_057277283.1 DUF2533 family protein -
  QNH50_RS21745 (QNH50_21745) - 4472667..4472876 (+) 210 WP_251432330.1 hypothetical protein -
  QNH50_RS21750 (QNH50_21750) nucA/comI 4472928..4473284 (+) 357 WP_096340856.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  QNH50_RS21755 (QNH50_21755) - 4473727..4474284 (-) 558 WP_283932182.1 hypothetical protein -
  QNH50_RS21760 (QNH50_21760) - 4474573..4475085 (-) 513 WP_230304320.1 hypothetical protein -
  QNH50_RS21765 (QNH50_21765) - 4475258..4475620 (-) 363 WP_230304321.1 hypothetical protein -
  QNH50_RS21770 (QNH50_21770) - 4475958..4477193 (+) 1236 WP_283932183.1 IS110 family transposase -
  QNH50_RS21775 (QNH50_21775) - 4477816..4478571 (-) 756 WP_148358479.1 SDR family oxidoreductase -
  QNH50_RS21780 (QNH50_21780) - 4478626..4479408 (-) 783 WP_230303645.1 MerR family transcriptional regulator -
  QNH50_RS21785 (QNH50_21785) - 4480018..4481253 (+) 1236 WP_283932181.1 IS110 family transposase -

Sequence


Protein


Download         Length: 118 a.a.        Molecular weight: 13133.27 Da        Isoelectric Point: 3.9017

>NTDB_id=835434 QNH50_RS21750 WP_096340856.1 4472928..4473284(+) (nucA/comI) [Peribacillus simplex strain D9_B_73]
MKVKECLSEESYNVVINFPSEKYPETAEHIEDAIADGSSNICTIDRNGADENRDESLENIQTRMGYDRDEYPMAMCEEGG
AGADIEYITPSDNRGAGSWVSHQLSDYPDGTKVLFVVE

Nucleotide


Download         Length: 357 bp        

>NTDB_id=835434 QNH50_RS21750 WP_096340856.1 4472928..4473284(+) (nucA/comI) [Peribacillus simplex strain D9_B_73]
ATCAAAGTAAAGGAGTGTTTATCTGAGGAAAGTTATAATGTTGTAATTAACTTTCCGTCAGAAAAGTACCCGGAGACAGC
TGAGCATATAGAAGATGCCATTGCTGATGGAAGTTCCAATATTTGTACCATTGATAGAAATGGAGCAGACGAGAACCGTG
ATGAATCTTTGGAAAATATTCAAACTAGAATGGGATATGATCGTGATGAATACCCAATGGCCATGTGTGAAGAAGGGGGA
GCGGGAGCAGATATTGAGTATATAACCCCATCAGACAATCGTGGTGCTGGCTCGTGGGTATCTCATCAATTAAGTGACTA
TCCCGATGGTACAAAGGTTTTATTCGTTGTAGAGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

63.551

90.678

0.576