Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH18_RS17415 Genome accession   NZ_CP126091
Coordinates   3371808..3371948 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain CEW 1W     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3366808..3376948
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH18_RS17390 (QNH18_17390) - 3367128..3367517 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  QNH18_RS17395 (QNH18_17395) comA 3367534..3368172 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  QNH18_RS17400 (QNH18_17400) - 3368259..3370559 (-) 2301 Protein_3376 ATP-binding protein -
  QNH18_RS17405 (QNH18_17405) comX 3370561..3370734 (-) 174 WP_009329510.1 competence pheromone ComX -
  QNH18_RS17410 (QNH18_17410) - 3370738..3371619 (-) 882 WP_039072958.1 polyprenyl synthetase family protein -
  QNH18_RS17415 (QNH18_17415) degQ 3371808..3371948 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  QNH18_RS17420 (QNH18_17420) - 3372434..3372781 (+) 348 WP_224146417.1 SDR family oxidoreductase -
  QNH18_RS17425 (QNH18_17425) - 3372824..3374044 (-) 1221 WP_020452793.1 HDOD domain-containing protein -
  QNH18_RS17430 (QNH18_17430) - 3374221..3375690 (-) 1470 WP_039072962.1 nicotinate phosphoribosyltransferase -
  QNH18_RS17435 (QNH18_17435) - 3375708..3376259 (-) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  QNH18_RS17440 (QNH18_17440) - 3376445..3376846 (-) 402 WP_025809741.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=835380 QNH18_RS17415 WP_003184860.1 3371808..3371948(-) (degQ) [Bacillus paralicheniformis strain CEW 1W]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=835380 QNH18_RS17415 WP_003184860.1 3371808..3371948(-) (degQ) [Bacillus paralicheniformis strain CEW 1W]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652