Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QNH18_RS13345 Genome accession   NZ_CP126091
Coordinates   2634520..2634696 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain CEW 1W     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2629520..2639696
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH18_RS13330 (QNH18_13330) gcvT 2630160..2631254 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  QNH18_RS13335 (QNH18_13335) - 2631849..2633528 (+) 1680 WP_020452163.1 SNF2-related protein -
  QNH18_RS13340 (QNH18_13340) - 2633535..2634329 (+) 795 WP_020452164.1 YqhG family protein -
  QNH18_RS13345 (QNH18_13345) sinI 2634520..2634696 (+) 177 WP_020452165.1 anti-repressor SinI family protein Regulator
  QNH18_RS13350 (QNH18_13350) sinR 2634730..2635065 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  QNH18_RS13355 (QNH18_13355) - 2635170..2635964 (-) 795 WP_020452167.1 TasA family protein -
  QNH18_RS13360 (QNH18_13360) - 2636037..2636621 (-) 585 WP_023855186.1 signal peptidase I -
  QNH18_RS13365 (QNH18_13365) tapA 2636618..2637346 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  QNH18_RS13370 (QNH18_13370) - 2637623..2637943 (+) 321 WP_101561076.1 YqzG/YhdC family protein -
  QNH18_RS13375 (QNH18_13375) - 2637973..2638155 (-) 183 WP_020452171.1 YqzE family protein -
  QNH18_RS13380 (QNH18_13380) comGG 2638244..2638609 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  QNH18_RS13385 (QNH18_13385) comGF 2638621..2639109 (-) 489 WP_223254778.1 competence type IV pilus minor pilin ComGF -
  QNH18_RS13390 (QNH18_13390) comGE 2639018..2639365 (-) 348 WP_101561077.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=835364 QNH18_RS13345 WP_020452165.1 2634520..2634696(+) (sinI) [Bacillus paralicheniformis strain CEW 1W]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=835364 QNH18_RS13345 WP_020452165.1 2634520..2634696(+) (sinI) [Bacillus paralicheniformis strain CEW 1W]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5