Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   QNH21_RS08745 Genome accession   NZ_CP126090
Coordinates   1752973..1753353 (+) Length   126 a.a.
NCBI ID   WP_243837381.1    Uniprot ID   -
Organism   Bacillus safensis strain CEW AP102     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1687568..1757464 1752973..1753353 within 0


Gene organization within MGE regions


Location: 1687568..1757464
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH21_RS08385 (QNH21_08385) - 1687568..1688317 (+) 750 WP_283860085.1 poly-gamma-glutamate hydrolase family protein -
  QNH21_RS08390 (QNH21_08390) - 1688479..1689627 (+) 1149 WP_024427032.1 Rap family tetratricopeptide repeat protein -
  QNH21_RS08395 (QNH21_08395) - 1689717..1691042 (-) 1326 WP_056766528.1 S8 family peptidase -
  QNH21_RS08400 (QNH21_08400) - 1691627..1692361 (+) 735 WP_283860086.1 poly-gamma-glutamate hydrolase family protein -
  QNH21_RS08405 (QNH21_08405) - 1692438..1692887 (+) 450 WP_268414401.1 OsmC family protein -
  QNH21_RS08410 (QNH21_08410) - 1692934..1693302 (-) 369 WP_024424093.1 multidrug efflux SMR transporter -
  QNH21_RS08415 (QNH21_08415) - 1693318..1693635 (-) 318 WP_024424092.1 multidrug efflux SMR transporter -
  QNH21_RS08420 (QNH21_08420) - 1693638..1693898 (-) 261 WP_249117528.1 hypothetical protein -
  QNH21_RS08425 (QNH21_08425) - 1693911..1694156 (-) 246 WP_255290955.1 helix-turn-helix domain-containing protein -
  QNH21_RS08430 (QNH21_08430) - 1694292..1694555 (-) 264 WP_025093279.1 hypothetical protein -
  QNH21_RS08435 (QNH21_08435) - 1694660..1695061 (+) 402 WP_034623557.1 YmaF family protein -
  QNH21_RS08440 (QNH21_08440) miaA 1695132..1696088 (+) 957 WP_197172853.1 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
  QNH21_RS08445 (QNH21_08445) hfq 1696114..1696335 (+) 222 WP_024424088.1 RNA chaperone Hfq -
  QNH21_RS08450 (QNH21_08450) - 1696498..1696818 (+) 321 WP_024424087.1 YmzC family protein -
  QNH21_RS08455 (QNH21_08455) - 1696898..1697110 (+) 213 WP_003212415.1 hypothetical protein -
  QNH21_RS08460 (QNH21_08460) nrdI 1697376..1697768 (+) 393 WP_008360380.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  QNH21_RS08465 (QNH21_08465) nrdE 1697728..1699830 (+) 2103 WP_024424086.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  QNH21_RS08470 (QNH21_08470) nrdF 1699848..1700822 (+) 975 WP_283860087.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  QNH21_RS08475 (QNH21_08475) - 1700917..1701534 (+) 618 WP_024424084.1 hypothetical protein -
  QNH21_RS08480 (QNH21_08480) - 1701602..1702360 (-) 759 WP_024427042.1 N-acetylmuramoyl-L-alanine amidase -
  QNH21_RS08485 (QNH21_08485) spoVK 1702681..1703640 (+) 960 WP_024424083.1 stage V sporulation protein K -
  QNH21_RS08490 (QNH21_08490) hflX 1703762..1705033 (+) 1272 WP_283860088.1 GTPase HflX -
  QNH21_RS08495 (QNH21_08495) - 1705040..1706320 (+) 1281 WP_283860089.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  QNH21_RS08500 (QNH21_08500) - 1706412..1706822 (+) 411 WP_283860090.1 MerR family transcriptional regulator -
  QNH21_RS08505 (QNH21_08505) glnA 1706883..1708217 (+) 1335 WP_025093273.1 type I glutamate--ammonia ligase -
  QNH21_RS08510 (QNH21_08510) - 1708263..1708454 (+) 192 WP_197172854.1 hypothetical protein -
  QNH21_RS08515 (QNH21_08515) - 1708574..1708678 (+) 105 WP_235183637.1 hypothetical protein -
  QNH21_RS08520 (QNH21_08520) - 1708759..1709613 (+) 855 WP_034623549.1 hypothetical protein -
  QNH21_RS08525 (QNH21_08525) - 1709658..1710039 (+) 382 Protein_1630 ArpU family phage packaging/lysis transcriptional regulator -
  QNH21_RS08530 (QNH21_08530) - 1710118..1711827 (+) 1710 Protein_1631 T7SS effector LXG polymorphic toxin -
  QNH21_RS08535 (QNH21_08535) - 1711840..1712244 (+) 405 WP_283860091.1 hypothetical protein -
  QNH21_RS08540 (QNH21_08540) - 1712726..1712905 (+) 180 WP_056702470.1 hypothetical protein -
  QNH21_RS08545 (QNH21_08545) - 1712997..1713341 (+) 345 WP_135031713.1 structural protein -
  QNH21_RS08550 (QNH21_08550) - 1713397..1713603 (+) 207 WP_235183636.1 hypothetical protein -
  QNH21_RS08555 (QNH21_08555) - 1713925..1714359 (+) 435 WP_034623546.1 hypothetical protein -
  QNH21_RS19285 terS 1715164..1716011 (+) 848 Protein_1637 phage terminase small subunit -
  QNH21_RS08575 (QNH21_08575) - 1716020..1717327 (+) 1308 WP_283860148.1 PBSX family phage terminase large subunit -
  QNH21_RS08580 (QNH21_08580) - 1717324..1718853 (+) 1530 WP_034623543.1 phage portal protein -
  QNH21_RS08585 (QNH21_08585) - 1718850..1719766 (+) 917 Protein_1640 phage minor head protein -
  QNH21_RS08590 (QNH21_08590) - 1719808..1720437 (+) 630 WP_034623542.1 hypothetical protein -
  QNH21_RS08595 (QNH21_08595) - 1720471..1720731 (+) 261 Protein_1642 XkdF-like putative serine protease domain-containing protein -
  QNH21_RS08600 (QNH21_08600) - 1720752..1720910 (-) 159 Protein_1643 BhlA/UviB family holin-like peptide -
  QNH21_RS08605 (QNH21_08605) - 1720981..1721862 (+) 882 WP_347343018.1 N-acetylmuramoyl-L-alanine amidase -
  QNH21_RS08610 (QNH21_08610) - 1722004..1724277 (-) 2274 WP_034623540.1 S8 family peptidase -
  QNH21_RS08615 (QNH21_08615) - 1724292..1725395 (-) 1104 WP_034623539.1 ATP-binding protein -
  QNH21_RS08620 (QNH21_08620) - 1725888..1726040 (+) 153 WP_235183634.1 DUF4325 domain-containing protein -
  QNH21_RS08625 (QNH21_08625) - 1726229..1727080 (-) 852 WP_034623537.1 hypothetical protein -
  QNH21_RS08630 (QNH21_08630) - 1727295..1728134 (+) 840 WP_283860092.1 SMI1/KNR4 family protein -
  QNH21_RS08635 (QNH21_08635) - 1728274..1728408 (+) 135 WP_283860093.1 hypothetical protein -
  QNH21_RS08640 (QNH21_08640) - 1728534..1730459 (+) 1926 WP_283860094.1 T7SS effector LXG polymorphic toxin -
  QNH21_RS08645 (QNH21_08645) - 1730466..1730942 (+) 477 WP_041109174.1 immunity protein YezG family protein -
  QNH21_RS08650 (QNH21_08650) - 1731007..1731468 (-) 462 WP_133743787.1 macro domain-containing protein -
  QNH21_RS08655 (QNH21_08655) - 1731697..1732278 (+) 582 WP_283860095.1 undecaprenyl-diphosphatase -
  QNH21_RS08660 (QNH21_08660) - 1732331..1732702 (-) 372 WP_283860096.1 iron chaperone -
  QNH21_RS08665 (QNH21_08665) - 1733234..1734346 (+) 1113 WP_103132502.1 tetratricopeptide repeat protein -
  QNH21_RS08670 (QNH21_08670) - 1735075..1735770 (-) 696 WP_283860097.1 YoaK family protein -
  QNH21_RS08675 (QNH21_08675) - 1735838..1737670 (-) 1833 WP_283860098.1 DNA ligase D -
  QNH21_RS08680 (QNH21_08680) - 1737786..1738634 (+) 849 WP_212048987.1 Ku protein -
  QNH21_RS08685 (QNH21_08685) - 1738658..1739101 (-) 444 WP_268415793.1 DUF2188 domain-containing protein -
  QNH21_RS08690 (QNH21_08690) - 1739262..1739735 (+) 474 WP_268415792.1 VOC family protein -
  QNH21_RS08695 (QNH21_08695) - 1739784..1740197 (+) 414 WP_034283385.1 Rrf2 family transcriptional regulator -
  QNH21_RS08700 (QNH21_08700) - 1740298..1741149 (+) 852 WP_283860099.1 SDR family oxidoreductase -
  QNH21_RS08705 (QNH21_08705) - 1741304..1742212 (+) 909 WP_087978135.1 DMT family transporter -
  QNH21_RS08710 (QNH21_08710) - 1742225..1742416 (-) 192 WP_025093255.1 hypothetical protein -
  QNH21_RS08715 (QNH21_08715) - 1742527..1744743 (+) 2217 WP_213405081.1 RNA ligase -
  QNH21_RS08720 (QNH21_08720) - 1744809..1745519 (+) 711 WP_024425121.1 DUF421 domain-containing protein -
  QNH21_RS08725 (QNH21_08725) - 1745747..1746325 (+) 579 WP_041109214.1 TetR/AcrR family transcriptional regulator -
  QNH21_RS08730 (QNH21_08730) - 1746348..1749491 (+) 3144 WP_283860100.1 bifunctional cytochrome P450/NADPH--P450 reductase -
  QNH21_RS08735 (QNH21_08735) - 1749686..1750594 (+) 909 WP_133743783.1 trypsin-like serine protease -
  QNH21_RS08740 (QNH21_08740) - 1750741..1752747 (+) 2007 WP_198457286.1 glycosyltransferase family 39 protein -
  QNH21_RS08745 (QNH21_08745) nucA/comI 1752973..1753353 (+) 381 WP_243837381.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  QNH21_RS08750 (QNH21_08750) - 1753498..1754346 (+) 849 WP_073205715.1 STAS domain-containing protein -
  QNH21_RS08755 (QNH21_08755) - 1754379..1754921 (-) 543 WP_122631360.1 IseA DL-endopeptidase inhibitor family protein -
  QNH21_RS08760 (QNH21_08760) - 1755216..1755533 (+) 318 WP_283860101.1 hypothetical protein -
  QNH21_RS08765 (QNH21_08765) lexA 1755709..1756329 (-) 621 WP_024425129.1 transcriptional repressor LexA -
  QNH21_RS08770 (QNH21_08770) yneA 1756488..1756799 (+) 312 WP_024425130.1 cell division suppressor protein YneA -
  QNH21_RS08775 (QNH21_08775) - 1756817..1757464 (+) 648 WP_122631359.1 recombinase family protein -

Sequence


Protein


Download         Length: 126 a.a.        Molecular weight: 13741.44 Da        Isoelectric Point: 8.5068

>NTDB_id=835295 QNH21_RS08745 WP_243837381.1 1752973..1753353(+) (nucA/comI) [Bacillus safensis strain CEW AP102]
MGTLLGGFGEKQAAKGADRYDHVVQFPKERYPETGTHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISGFPDGKRILFIVK

Nucleotide


Download         Length: 381 bp        

>NTDB_id=835295 QNH21_RS08745 WP_243837381.1 1752973..1753353(+) (nucA/comI) [Bacillus safensis strain CEW AP102]
ATGGGCACGTTGTTAGGTGGATTTGGAGAGAAGCAGGCAGCAAAAGGGGCTGATCGATATGATCATGTCGTTCAATTTCC
AAAGGAAAGGTACCCTGAAACAGGCACTCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACCATTGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACAAAACCTGGCTTTGACCGGGATGAATGGCCA
ATGGCGGTTTGTCTTGAGGGAGGAAAAGGCGCAAGCGTACAATATGTCAGTCCATCTGATAATAGGGGAGCAGGCTCATG
GGTCGGGCATCAAATCAGCGGGTTTCCTGATGGGAAAAGAATATTATTCATTGTGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.983

94.444

0.548