Detailed information    

insolico Bioinformatically predicted

Overview


Name   kre   Type   Regulator
Locus tag   QNH35_RS07330 Genome accession   NZ_CP126081
Coordinates   1454361..1454822 (-) Length   153 a.a.
NCBI ID   WP_044139814.1    Uniprot ID   A0AB34QXM2
Organism   Bacillus pumilus strain B2_10     
Function   regulation of regulators (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1454988..1491125 1454361..1454822 flank 166


Gene organization within MGE regions


Location: 1454361..1491125
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH35_RS07330 (QNH35_07330) kre 1454361..1454822 (-) 462 WP_044139814.1 YkyB family protein Regulator
  QNH35_RS07335 (QNH35_07335) - 1454988..1456145 (-) 1158 WP_047947392.1 tyrosine-type recombinase/integrase -
  QNH35_RS07340 (QNH35_07340) - 1456190..1456666 (-) 477 WP_283924430.1 ImmA/IrrE family metallo-endopeptidase -
  QNH35_RS07345 (QNH35_07345) - 1456679..1457038 (-) 360 WP_061418827.1 helix-turn-helix transcriptional regulator -
  QNH35_RS07350 (QNH35_07350) - 1457154..1457393 (+) 240 WP_283924431.1 helix-turn-helix transcriptional regulator -
  QNH35_RS07355 (QNH35_07355) - 1457474..1457746 (+) 273 WP_283924432.1 hypothetical protein -
  QNH35_RS07360 (QNH35_07360) - 1457896..1458546 (+) 651 WP_283924433.1 Rha family transcriptional regulator -
  QNH35_RS07365 (QNH35_07365) - 1458738..1459193 (+) 456 WP_283924434.1 hypothetical protein -
  QNH35_RS07370 (QNH35_07370) - 1459381..1459650 (-) 270 WP_283924435.1 hypothetical protein -
  QNH35_RS07375 (QNH35_07375) - 1459791..1460552 (+) 762 WP_283924436.1 hypothetical protein -
  QNH35_RS07380 (QNH35_07380) - 1460717..1461118 (+) 402 WP_075621652.1 hypothetical protein -
  QNH35_RS07385 (QNH35_07385) - 1461129..1461899 (+) 771 WP_047947400.1 hypothetical protein -
  QNH35_RS07390 (QNH35_07390) - 1461892..1462251 (+) 360 WP_250026781.1 replicative helicase loader/inhibitor -
  QNH35_RS07395 (QNH35_07395) dnaB 1462248..1463576 (+) 1329 WP_061418855.1 replicative DNA helicase -
  QNH35_RS07400 (QNH35_07400) - 1463835..1464209 (-) 375 WP_185106924.1 hypothetical protein -
  QNH35_RS07405 (QNH35_07405) - 1464286..1464477 (+) 192 WP_185106922.1 XtrA/YqaO family protein -
  QNH35_RS07410 (QNH35_07410) - 1464749..1465183 (+) 435 WP_185106920.1 ArpU family phage packaging/lysis transcriptional regulator -
  QNH35_RS07415 (QNH35_07415) - 1465264..1465911 (+) 648 WP_283924437.1 hypothetical protein -
  QNH35_RS07420 (QNH35_07420) - 1466132..1466914 (+) 783 WP_276736209.1 hypothetical protein -
  QNH35_RS07425 (QNH35_07425) - 1467574..1467711 (+) 138 WP_283924438.1 hypothetical protein -
  QNH35_RS07430 (QNH35_07430) - 1467774..1467995 (+) 222 WP_283924439.1 hypothetical protein -
  QNH35_RS07435 (QNH35_07435) - 1467974..1468462 (+) 489 WP_106032434.1 phage terminase small subunit P27 family -
  QNH35_RS07440 (QNH35_07440) - 1468449..1470176 (+) 1728 WP_283924440.1 terminase TerL endonuclease subunit -
  QNH35_RS07445 (QNH35_07445) - 1470191..1470391 (+) 201 WP_061418892.1 hypothetical protein -
  QNH35_RS07450 (QNH35_07450) - 1470398..1471633 (+) 1236 WP_283924441.1 phage portal protein -
  QNH35_RS07455 (QNH35_07455) - 1471611..1472201 (+) 591 WP_185107940.1 HK97 family phage prohead protease -
  QNH35_RS07460 (QNH35_07460) - 1472256..1473437 (+) 1182 WP_283924442.1 phage major capsid protein -
  QNH35_RS07465 (QNH35_07465) - 1473450..1473752 (+) 303 WP_283924443.1 head-tail connector protein -
  QNH35_RS07470 (QNH35_07470) - 1473734..1474066 (+) 333 WP_113387281.1 head-tail adaptor protein -
  QNH35_RS07475 (QNH35_07475) - 1474066..1474449 (+) 384 WP_185106900.1 HK97-gp10 family putative phage morphogenesis protein -
  QNH35_RS07480 (QNH35_07480) - 1474446..1474838 (+) 393 WP_283924444.1 hypothetical protein -
  QNH35_RS07485 (QNH35_07485) - 1474853..1475461 (+) 609 WP_185106897.1 major tail protein -
  QNH35_RS07490 (QNH35_07490) - 1475536..1475859 (+) 324 WP_185106895.1 hypothetical protein -
  QNH35_RS07495 (QNH35_07495) - 1476087..1479749 (+) 3663 WP_283924445.1 phage tail tape measure protein -
  QNH35_RS07500 (QNH35_07500) - 1479746..1480573 (+) 828 WP_283924446.1 phage tail domain-containing protein -
  QNH35_RS07505 (QNH35_07505) - 1480582..1482483 (+) 1902 WP_283924447.1 phage tail protein -
  QNH35_RS07510 (QNH35_07510) - 1482543..1484396 (+) 1854 WP_283924448.1 right-handed parallel beta-helix repeat-containing protein -
  QNH35_RS07515 (QNH35_07515) - 1484408..1486012 (+) 1605 WP_283924449.1 BppU family phage baseplate upper protein -
  QNH35_RS07520 (QNH35_07520) - 1486028..1486300 (+) 273 WP_265208112.1 hypothetical protein -
  QNH35_RS07525 (QNH35_07525) - 1486297..1486443 (+) 147 WP_106038152.1 XkdX family protein -
  QNH35_RS07530 (QNH35_07530) - 1486483..1486695 (+) 213 WP_034324986.1 BhlA/UviB family holin-like peptide -
  QNH35_RS07535 (QNH35_07535) - 1486719..1486982 (+) 264 WP_265208113.1 phage holin -
  QNH35_RS07540 (QNH35_07540) - 1487044..1487844 (+) 801 WP_283924450.1 N-acetylmuramoyl-L-alanine amidase -
  QNH35_RS07545 (QNH35_07545) - 1487932..1488759 (-) 828 WP_283924451.1 HNH endonuclease -
  QNH35_RS07550 (QNH35_07550) - 1488831..1489688 (-) 858 WP_283924452.1 SMI1/KNR4 family protein -
  QNH35_RS07555 (QNH35_07555) - 1489871..1491004 (+) 1134 WP_283924453.1 aspartate phosphatase -
  QNH35_RS07560 (QNH35_07560) - 1490994..1491125 (+) 132 WP_265208118.1 hypothetical protein -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 17683.29 Da        Isoelectric Point: 10.2294

>NTDB_id=834752 QNH35_RS07330 WP_044139814.1 1454361..1454822(-) (kre) [Bacillus pumilus strain B2_10]
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGKKVGLHFSNNPKYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=834752 QNH35_RS07330 WP_044139814.1 1454361..1454822(-) (kre) [Bacillus pumilus strain B2_10]
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGTCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAAAAAAGTGGGCCTACATTTCTCTAACAATCCCAAATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCACCTGCCACCAACCAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAACCGAGCAAAGCAAATCCTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACGAAACCCGTCTTCAAACGACTAGGGGAAAGTTATTTTTAA

Domains


Predicted by InterproScan.

(14-127)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  kre Bacillus subtilis subsp. subtilis str. 168

76.623

100

0.771