Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   QNK08_RS13105 Genome accession   NZ_CP125983
Coordinates   2438242..2438652 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain ZKY04     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2433608..2461538 2438242..2438652 within 0


Gene organization within MGE regions


Location: 2433608..2461538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK08_RS13080 (QNK08_13090) yqeF 2433775..2434506 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  QNK08_RS13085 (QNK08_13095) cwlH 2434758..2435510 (-) 753 WP_264379321.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  QNK08_RS13090 (QNK08_13100) yqeD 2435697..2436323 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  QNK08_RS13095 (QNK08_13105) gnd 2436342..2437235 (-) 894 WP_069837643.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  QNK08_RS13100 (QNK08_13110) yqeB 2437487..2438209 (+) 723 WP_014480321.1 hypothetical protein -
  QNK08_RS13105 (QNK08_13115) nucA/comI 2438242..2438652 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  QNK08_RS13110 (QNK08_13120) sigK 2438848..2439576 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  QNK08_RS13115 (QNK08_13125) - 2439576..2439674 (+) 99 WP_031600702.1 hypothetical protein -
  QNK08_RS13120 (QNK08_13130) - 2439671..2439883 (-) 213 Protein_2535 recombinase family protein -
  QNK08_RS13125 (QNK08_13135) fumC 2440102..2441490 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  QNK08_RS13130 (QNK08_13140) - 2441657..2442547 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  QNK08_RS13135 (QNK08_13145) - 2443489..2443884 (+) 396 WP_046160622.1 VOC family protein -
  QNK08_RS13140 (QNK08_13155) - 2444624..2445751 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  QNK08_RS13145 - 2445933..2446766 (+) 834 Protein_2540 ribonuclease YeeF family protein -
  QNK08_RS13150 - 2447188..2447859 (+) 672 WP_228224803.1 hypothetical protein -
  QNK08_RS13155 (QNK08_13165) - 2447873..2448160 (+) 288 WP_014480331.1 hypothetical protein -
  QNK08_RS13160 (QNK08_13170) - 2448563..2449003 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  QNK08_RS13165 (QNK08_13175) - 2449102..2449554 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  QNK08_RS13170 (QNK08_13180) cdiI 2449651..2450010 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  QNK08_RS13175 (QNK08_13185) - 2450115..2450594 (+) 480 WP_224588637.1 hypothetical protein -
  QNK08_RS13180 (QNK08_13190) - 2450902..2451105 (-) 204 WP_123772462.1 hypothetical protein -
  QNK08_RS13185 (QNK08_13195) - 2451194..2451427 (+) 234 WP_224588641.1 hypothetical protein -
  QNK08_RS13190 (QNK08_13200) atxG 2451695..2452272 (+) 578 Protein_2549 suppressor of fused domain protein -
  QNK08_RS13195 (QNK08_13205) - 2452382..2452672 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  QNK08_RS13200 (QNK08_13210) istA 2453513..2455060 (+) 1548 WP_014480339.1 IS21 family transposase -
  QNK08_RS13205 (QNK08_13215) istB 2455057..2455815 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  QNK08_RS13210 - 2456067..2456233 (-) 167 Protein_2553 peptidoglycan-binding domain-containing protein -
  QNK08_RS13215 (QNK08_13225) - 2456408..2456494 (+) 87 WP_072592549.1 putative holin-like toxin -
  QNK08_RS13220 - 2456781..2457256 (-) 476 Protein_2555 phage tail tube protein -
  QNK08_RS13225 (QNK08_13240) terS 2457216..2457780 (-) 565 Protein_2556 phage terminase small subunit -
  QNK08_RS13230 (QNK08_13245) - 2457907..2458212 (+) 306 WP_264379322.1 hypothetical protein -
  QNK08_RS13235 (QNK08_13255) - 2458605..2459084 (-) 480 WP_014480344.1 hypothetical protein -
  QNK08_RS13240 (QNK08_13260) - 2459701..2459967 (+) 267 WP_033881358.1 hypothetical protein -
  QNK08_RS13245 (QNK08_13265) - 2460106..2460258 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  QNK08_RS13250 (QNK08_13270) - 2460341..2460463 (-) 123 Protein_2561 RusA family crossover junction endodeoxyribonuclease -
  QNK08_RS13255 (QNK08_13275) - 2460426..2460674 (-) 249 Protein_2562 hypothetical protein -
  QNK08_RS13260 (QNK08_13280) - 2460819..2461049 (-) 231 WP_224588644.1 hypothetical protein -
  QNK08_RS13265 (QNK08_13285) - 2461358..2461538 (-) 181 Protein_2564 hypothetical protein -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=834077 QNK08_RS13105 WP_009967785.1 2438242..2438652(-) (nucA/comI) [Bacillus subtilis strain ZKY04]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=834077 QNK08_RS13105 WP_009967785.1 2438242..2438652(-) (nucA/comI) [Bacillus subtilis strain ZKY04]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529