Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QLQ05_RS09300 Genome accession   NZ_CP125762
Coordinates   1745826..1745999 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain KRS015     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1740826..1750999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ05_RS09255 comGE 1741177..1741524 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QLQ05_RS09260 comGF 1741550..1741933 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QLQ05_RS09265 comGG 1741934..1742308 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QLQ05_RS09270 spoIIT 1742379..1742558 (+) 180 WP_003230176.1 YqzE family protein -
  QLQ05_RS09275 yqzG 1742600..1742926 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  QLQ05_RS09280 tapA 1743198..1743959 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QLQ05_RS09285 sipW 1743943..1744515 (+) 573 WP_003246088.1 signal peptidase I SipW -
  QLQ05_RS09290 tasA 1744579..1745364 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  QLQ05_RS09295 sinR 1745457..1745792 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QLQ05_RS09300 sinI 1745826..1745999 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  QLQ05_RS09305 yqhG 1746182..1746976 (-) 795 WP_003230200.1 YqhG family protein -
  QLQ05_RS09310 yqhH 1746997..1748670 (-) 1674 WP_004398544.1 SNF2-related protein -
  QLQ05_RS09315 gcvT 1749112..1750200 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=832711 QLQ05_RS09300 WP_003230187.1 1745826..1745999(-) (sinI) [Bacillus subtilis strain KRS015]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=832711 QLQ05_RS09300 WP_003230187.1 1745826..1745999(-) (sinI) [Bacillus subtilis strain KRS015]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1