Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   HX0037_RS13940 Genome accession   NZ_CP139782
Coordinates   2863687..2863827 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain HX0037     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2858687..2868827
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HX0037_RS13915 - 2858994..2859392 (+) 399 WP_003152031.1 YueI family protein -
  HX0037_RS13920 - 2859489..2860040 (+) 552 WP_146275407.1 cysteine hydrolase family protein -
  HX0037_RS13925 - 2860058..2861524 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  HX0037_RS13930 - 2861654..2862874 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  HX0037_RS13935 - 2862881..2863222 (-) 342 WP_014305721.1 hypothetical protein -
  HX0037_RS13940 degQ 2863687..2863827 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HX0037_RS13945 comQ 2863979..2864890 (+) 912 WP_031378407.1 polyprenyl synthetase family protein Regulator
  HX0037_RS13950 comX 2864890..2865054 (+) 165 WP_007613432.1 competence pheromone ComX -
  HX0037_RS13955 comP 2865066..2867357 (+) 2292 WP_094247540.1 histidine kinase Regulator
  HX0037_RS13960 comA 2867438..2868082 (+) 645 WP_330537779.1 response regulator transcription factor Regulator
  HX0037_RS13965 - 2868104..2868487 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=831423 HX0037_RS13940 WP_003152043.1 2863687..2863827(+) (degQ) [Bacillus amyloliquefaciens strain HX0037]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=831423 HX0037_RS13940 WP_003152043.1 2863687..2863827(+) (degQ) [Bacillus amyloliquefaciens strain HX0037]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891