Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | HX0037_RS13940 | Genome accession | NZ_CP139782 |
| Coordinates | 2863687..2863827 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain HX0037 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2858687..2868827
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HX0037_RS13915 | - | 2858994..2859392 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| HX0037_RS13920 | - | 2859489..2860040 (+) | 552 | WP_146275407.1 | cysteine hydrolase family protein | - |
| HX0037_RS13925 | - | 2860058..2861524 (+) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| HX0037_RS13930 | - | 2861654..2862874 (+) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| HX0037_RS13935 | - | 2862881..2863222 (-) | 342 | WP_014305721.1 | hypothetical protein | - |
| HX0037_RS13940 | degQ | 2863687..2863827 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| HX0037_RS13945 | comQ | 2863979..2864890 (+) | 912 | WP_031378407.1 | polyprenyl synthetase family protein | Regulator |
| HX0037_RS13950 | comX | 2864890..2865054 (+) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| HX0037_RS13955 | comP | 2865066..2867357 (+) | 2292 | WP_094247540.1 | histidine kinase | Regulator |
| HX0037_RS13960 | comA | 2867438..2868082 (+) | 645 | WP_330537779.1 | response regulator transcription factor | Regulator |
| HX0037_RS13965 | - | 2868104..2868487 (+) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=831423 HX0037_RS13940 WP_003152043.1 2863687..2863827(+) (degQ) [Bacillus amyloliquefaciens strain HX0037]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=831423 HX0037_RS13940 WP_003152043.1 2863687..2863827(+) (degQ) [Bacillus amyloliquefaciens strain HX0037]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |