Detailed information NTG0831247

Bioinformatically predicted

Overview

• Name: comS
• Type: Regulator
• Locus tag: OPT59_RS00355
• Genome accession: NZ_CP125360
• Coordinates: 56939..57034 (+)
• Length: 31 a.a.
• NCBI ID: WP_198455558.1
• Uniprot ID: -
• Organism: Streptococcus dysgalactiae subsp. equisimilis strain UT_120444
• Function: activate transcription of comX (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	57138..58271	56939..57034	flank	104

Gene organization within MGE regions

Location: 56939..58271

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OPT59_RS00355 (OPT59_00355)	comS	56939..57034 (+)	96	WP_198455558.1	quorum-sensing system DWW-type pheromone	Regulator
OPT59_RS00360 (OPT59_00360)	-	57138..58271 (+)	1134	WP_022554244.1	ISAs1-like element IS1548 family transposase	-

Sequence

Protein

• Length: 31 a.a.
• Molecular weight: 3929.72 Da
• Isoelectric Point: 10.1669

>NTDB_id=831247 OPT59_RS00355 WP_198455558.1 56939..57034(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain UT_120444]
MFKRYHYYFILTAMLAFKAAQMISQVDWWRL

Nucleotide

• Length: 96 bp

>NTDB_id=831247 OPT59_RS00355 WP_198455558.1 56939..57034(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain UT_120444]
ATGTTCAAAAGATATCACTACTATTTTATACTTACTGCTATGTTAGCATTTAAAGCAGCTCAGATGATAAGTCAAGTGGA
TTGGTGGCGTTTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comS	Streptococcus pyogenes MGAS8232	61.29	100	0.613
comS	Streptococcus pyogenes MGAS315	38.71	100	0.387