Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   QL280_RS02355 Genome accession   NZ_CP125291
Coordinates   470230..470379 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 105_Kz     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 465230..475379
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QL280_RS02330 (QL280_02330) blpC 465494..465649 (-) 156 WP_000358812.1 quorum-sensing system pheromone BlpC -
  QL280_RS02335 (QL280_02335) - 465706..467067 (-) 1362 WP_001069065.1 bacteriocin secretion accessory protein -
  QL280_RS02340 (QL280_02340) comA/nlmT 467078..469231 (-) 2154 WP_000205159.1 peptide cleavage/export ABC transporter BlpA Regulator
  QL280_RS02345 (QL280_02345) blpM 469513..469767 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  QL280_RS02350 (QL280_02350) blpN 469783..469986 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  QL280_RS02355 (QL280_02355) cipB 470230..470379 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  QL280_RS02360 (QL280_02360) - 470483..470602 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  QL280_RS02365 (QL280_02365) - 471122..471441 (+) 320 Protein_464 immunity protein -
  QL280_RS10435 - 471794..471987 (+) 194 Protein_465 hypothetical protein -
  QL280_RS02370 (QL280_02370) - 472070..472453 (+) 384 WP_000877381.1 hypothetical protein -
  QL280_RS02375 (QL280_02375) - 472505..473194 (+) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  QL280_RS02380 (QL280_02380) blpZ 473236..473484 (+) 249 WP_000276499.1 immunity protein BlpZ -
  QL280_RS02385 (QL280_02385) - 473514..474125 (+) 612 WP_000394030.1 type II CAAX endopeptidase family protein -
  QL280_RS02390 (QL280_02390) - 474287..475081 (+) 795 WP_000363002.1 phosphotransferase family protein -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=830806 QL280_RS02355 WP_001809846.1 470230..470379(+) (cipB) [Streptococcus pneumoniae strain 105_Kz]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=830806 QL280_RS02355 WP_001809846.1 470230..470379(+) (cipB) [Streptococcus pneumoniae strain 105_Kz]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531