Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   R6Z04_RS13365 Genome accession   NZ_CP139440
Coordinates   2552108..2552281 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain GUCC4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547108..2557281
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Z04_RS13350 (R6Z04_13350) gcvT 2547907..2548995 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  R6Z04_RS13355 (R6Z04_13355) hepAA 2549437..2551110 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  R6Z04_RS13360 (R6Z04_13360) yqhG 2551131..2551925 (+) 795 WP_003230200.1 YqhG family protein -
  R6Z04_RS13365 (R6Z04_13365) sinI 2552108..2552281 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6Z04_RS13370 (R6Z04_13370) sinR 2552315..2552650 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6Z04_RS13375 (R6Z04_13375) tasA 2552743..2553528 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  R6Z04_RS13380 (R6Z04_13380) sipW 2553592..2554164 (-) 573 WP_003246088.1 signal peptidase I SipW -
  R6Z04_RS13385 (R6Z04_13385) tapA 2554148..2554909 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  R6Z04_RS13390 (R6Z04_13390) yqzG 2555181..2555507 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R6Z04_RS13395 (R6Z04_13395) spoIITA 2555549..2555728 (-) 180 WP_003230176.1 YqzE family protein -
  R6Z04_RS13400 (R6Z04_13400) comGG 2555799..2556173 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  R6Z04_RS13405 (R6Z04_13405) comGF 2556174..2556557 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  R6Z04_RS13410 (R6Z04_13410) comGE 2556583..2556930 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=830489 R6Z04_RS13365 WP_003230187.1 2552108..2552281(+) (sinI) [Bacillus subtilis strain GUCC4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=830489 R6Z04_RS13365 WP_003230187.1 2552108..2552281(+) (sinI) [Bacillus subtilis strain GUCC4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1