Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QKW11_RS15350 Genome accession   NZ_CP124851
Coordinates   3128703..3128843 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SF305     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3123703..3133843
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QKW11_RS15325 (QKW11_15305) - 3124080..3124463 (-) 384 WP_095352718.1 hotdog fold thioesterase -
  QKW11_RS15330 (QKW11_15310) comA 3124485..3125129 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QKW11_RS15335 (QKW11_15315) comP 3125210..3127438 (-) 2229 WP_404841490.1 ATP-binding protein Regulator
  QKW11_RS15340 (QKW11_15320) - 3127458..3127634 (-) 177 WP_007408675.1 competence pheromone ComX -
  QKW11_RS15345 (QKW11_15325) comQ 3127634..3128572 (-) 939 WP_269465507.1 class 1 isoprenoid biosynthesis enzyme Regulator
  QKW11_RS15350 (QKW11_15330) degQ 3128703..3128843 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QKW11_RS15355 (QKW11_15335) - 3129309..3129650 (+) 342 WP_007408677.1 hypothetical protein -
  QKW11_RS15360 (QKW11_15340) - 3129657..3130880 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  QKW11_RS15365 (QKW11_15345) - 3131010..3132476 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  QKW11_RS15370 (QKW11_15350) - 3132494..3133045 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  QKW11_RS15375 (QKW11_15355) - 3133142..3133540 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=828392 QKW11_RS15350 WP_003152043.1 3128703..3128843(-) (degQ) [Bacillus velezensis strain SF305]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=828392 QKW11_RS15350 WP_003152043.1 3128703..3128843(-) (degQ) [Bacillus velezensis strain SF305]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891