Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8635_RS08630 Genome accession   NZ_AP026924
Coordinates   1672767..1672916 (-) Length   49 a.a.
NCBI ID   WP_001820573.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900700063     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1667767..1677916
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8635_RS08600 (PC0062_17090) - 1668554..1669507 (+) 954 WP_001155321.1 IS30-like element ISSpn8 family transposase -
  R8635_RS08605 - 1669597..1670208 (-) 612 WP_000394049.1 CPBP family intramembrane glutamic endopeptidase -
  R8635_RS08610 (PC0062_17100) blpZ 1670359..1670592 (-) 234 WP_001818347.1 immunity protein BlpZ -
  R8635_RS08615 (PC0062_17110) - 1670634..1671323 (-) 690 WP_000760510.1 CPBP family intramembrane glutamic endopeptidase -
  R8635_RS08620 (PC0062_17120) - 1671375..1671758 (-) 384 WP_000877381.1 hypothetical protein -
  R8635_RS08625 - 1672544..1672663 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R8635_RS08630 (PC0062_17140) cipB 1672767..1672916 (-) 150 WP_001820573.1 bacteriocin-like peptide BlpO Regulator
  R8635_RS08635 (PC0062_17150) blpN 1673160..1673363 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R8635_RS08640 (PC0062_17160) blpM 1673379..1673633 (-) 255 WP_000379877.1 two-peptide bacteriocin subunit BlpM -
  R8635_RS08645 - 1673783..1674586 (-) 804 Protein_1718 IS5 family transposase -
  R8635_RS08650 (PC0062_17190) - 1674789..1675193 (-) 405 WP_000846944.1 hypothetical protein -
  R8635_RS08655 (PC0062_17200) - 1675190..1675354 (-) 165 WP_000727118.1 hypothetical protein -
  R8635_RS08660 - 1675651..1675770 (-) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  R8635_RS08665 (PC0062_17210) blpU 1675773..1676003 (-) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  R8635_RS08670 (PC0062_17220) blpJ 1676072..1676341 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  R8635_RS08675 (PC0062_17240) blpI 1676808..1677005 (-) 198 WP_001093261.1 bacteriocin-like peptide BlpI -
  R8635_RS08680 (PC0062_17250) comA/nlmT 1677303..1677890 (+) 588 WP_317657537.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.91 Da        Isoelectric Point: 3.9133

>NTDB_id=82575 R8635_RS08630 WP_001820573.1 1672767..1672916(-) (cipB) [Streptococcus pneumoniae strain PZ900700063]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=82575 R8635_RS08630 WP_001820573.1 1672767..1672916(-) (cipB) [Streptococcus pneumoniae strain PZ900700063]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51