Detailed information NTG0082483

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: R8625_RS09595
• Genome accession: NZ_AP026923
• Coordinates: 1848380..1848643 (-)
• Length: 87 a.a.
• NCBI ID: WP_000962025.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain PZ900700054
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1843380..1853643

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R8625_RS09550 (PC0054_18580)	rnpA	1843398..1843769 (-)	372	WP_000739246.1	ribonuclease P protein component	-
R8625_RS09555	-	1843786..1843917 (-)	132	WP_000768904.1	hypothetical protein	-
R8625_RS09560 (PC0054_18590)	-	1843918..1845108 (-)	1191	WP_000167769.1	acetate kinase	-
R8625_RS09565 (PC0054_18600)	comGH	1845159..1846112 (-)	954	WP_317649157.1	class I SAM-dependent methyltransferase	Machinery gene
R8625_RS09570	-	1846173..1846767 (-)	595	Protein_1857	class I SAM-dependent methyltransferase	-
R8625_RS09575 (PC0054_18630)	comGG/cglG	1846870..1847316 (-)	447	WP_001811371.1	competence type IV pilus minor pilin ComGG	Machinery gene
R8625_RS09580 (PC0054_18640)	comGF/cglF	1847294..1847755 (-)	462	WP_000250523.1	competence type IV pilus minor pilin ComGF	Machinery gene
R8625_RS09585 (PC0054_18650)	comGE/cglE	1847718..1848020 (-)	303	WP_317649158.1	competence type IV pilus minor pilin ComGE	Machinery gene
R8625_RS09590 (PC0054_18660)	comGD/cglD	1847983..1848417 (-)	435	WP_000608686.1	competence type IV pilus minor pilin ComGD	Machinery gene
R8625_RS09595 (PC0054_18670)	comGC/cglC	1848380..1848643 (-)	264	WP_000962025.1	competence type IV pilus major pilin ComGC	Machinery gene
R8625_RS09600 (PC0054_18680)	-	1848645..1848902 (-)	258	WP_000698511.1	hypothetical protein	-
R8625_RS09605 (PC0054_18690)	-	1849173..1850129 (-)	957	WP_219601358.1	N-acetylmuramoyl-L-alanine amidase family protein	-
R8625_RS09610 (PC0054_18700)	-	1850133..1850465 (-)	333	WP_050085269.1	phage holin	-
R8625_RS09615 (PC0054_18710)	-	1850469..1850768 (-)	300	WP_001811580.1	hypothetical protein	-
R8625_RS09620 (PC0054_18720)	-	1850777..1851127 (-)	351	WP_000852245.1	hypothetical protein	-
R8625_RS09625 (PC0054_18730)	-	1851130..1851333 (-)	204	WP_001091109.1	hypothetical protein	-
R8625_RS09630	-	1851314..1851430 (-)	117	WP_001063633.1	hypothetical protein	-

Sequence

Protein

• Length: 87 a.a.
• Molecular weight: 9877.37 Da
• Isoelectric Point: 5.8577

>NTDB_id=82483 R8625_RS09595 WP_000962025.1 1848380..1848643(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900700054]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQDDGRITEEQAKAYKEYHDKQN
TSQIVKD

Nucleotide

• Length: 264 bp

>NTDB_id=82483 R8625_RS09595 WP_000962025.1 1848380..1848643(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900700054]
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGAAAGTTACAAGACGATGGACGCATCACGGAAGAACAGGCTAAAGCCTATAAAGAATACCATGATAAACAAAAT
ACTAGTCAAATCGTTAAAGATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	93.902	94.253	0.885
comGC/cglC	Streptococcus pneumoniae D39	93.902	94.253	0.885
comGC/cglC	Streptococcus pneumoniae R6	93.902	94.253	0.885
comGC/cglC	Streptococcus pneumoniae TIGR4	92.683	94.253	0.874
comGC/cglC	Streptococcus mitis NCTC 12261	91.781	83.908	0.77
comGC/cglC	Streptococcus mitis SK321	85.294	78.161	0.667
comGC	Streptococcus gordonii str. Challis substr. CH1	68.293	94.253	0.644
comGC	Streptococcus suis isolate S10	66.667	82.759	0.552
comGC	Streptococcus mutans UA140	61.905	72.414	0.448
comGC	Streptococcus mutans UA159	61.905	72.414	0.448
comGC	Lactococcus lactis subsp. cremoris KW2	50	80.46	0.402
comGC	Staphylococcus aureus MW2	46.377	79.31	0.368
comGC	Staphylococcus aureus N315	46.377	79.31	0.368