Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4711_RS05090 Genome accession   NZ_CP137107
Coordinates   1018485..1018643 (-) Length   52 a.a.
NCBI ID   WP_001093073.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 15H4024     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1013485..1023643
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4711_RS05075 comB 1014255..1015604 (-) 1350 WP_000801630.1 competence pheromone export protein ComB Regulator
  R4711_RS05080 comA 1015617..1017770 (-) 2154 WP_000668291.1 peptide cleavage/export ABC transporter ComA Regulator
  R4711_RS05085 - 1018357..1018482 (-) 126 WP_000346297.1 PncF family bacteriocin immunity protein -
  R4711_RS05090 cipB 1018485..1018643 (-) 159 WP_001093073.1 bacteriocin class II family protein Regulator
  R4711_RS05095 - 1018846..1019145 (-) 300 Protein_1014 transposase family protein -
  R4711_RS05100 - 1019182..1019415 (-) 234 WP_000136447.1 acyl carrier protein -
  R4711_RS05105 plsX 1019421..1020413 (-) 993 WP_000717457.1 phosphate acyltransferase PlsX -
  R4711_RS05110 recO 1020410..1021180 (-) 771 WP_000616157.1 DNA repair protein RecO Machinery gene
  R4711_RS05115 - 1021177..1022346 (-) 1170 WP_000366343.1 pyridoxal phosphate-dependent aminotransferase -
  R4711_RS05120 - 1022495..1023505 (+) 1011 WP_000009157.1 YeiH family protein -

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5435.25 Da        Isoelectric Point: 4.2644

>NTDB_id=819265 R4711_RS05090 WP_001093073.1 1018485..1018643(-) (cipB) [Streptococcus pneumoniae strain 15H4024]
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW

Nucleotide


Download         Length: 159 bp        

>NTDB_id=819265 R4711_RS05090 WP_001093073.1 1018485..1018643(-) (cipB) [Streptococcus pneumoniae strain 15H4024]
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-51)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44

96.154

0.423