Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4711_RS02905 Genome accession   NZ_CP137107
Coordinates   580198..580347 (-) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 15H4024     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 575198..585347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4711_RS02870 trmB 575441..576076 (-) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  R4711_RS02875 ccrZ 576073..576867 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  R4711_RS02880 - 577028..577639 (-) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  R4711_RS02885 blpZ 577790..578023 (-) 234 WP_000276498.1 immunity protein BlpZ -
  R4711_RS02890 - 578065..578754 (-) 690 WP_000760541.1 CPBP family intramembrane glutamic endopeptidase -
  R4711_RS02895 - 578806..579189 (-) 384 WP_000877378.1 hypothetical protein -
  R4711_RS02900 - 579975..580094 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4711_RS02905 cipB 580198..580347 (-) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator
  R4711_RS02910 blpN 580591..580794 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R4711_RS02915 blpM 580810..581064 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  R4711_RS02920 - 581266..582071 (-) 806 Protein_581 IS5 family transposase -
  R4711_RS02925 - 582269..582673 (-) 405 WP_000846944.1 hypothetical protein -
  R4711_RS02930 - 582670..582834 (-) 165 WP_000727118.1 hypothetical protein -
  R4711_RS02935 - 583131..583250 (-) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  R4711_RS02940 blpU 583253..583483 (-) 231 WP_001093268.1 bacteriocin-like peptide BlpU -
  R4711_RS02945 comA/nlmT 583764..584351 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=819244 R4711_RS02905 WP_001813641.1 580198..580347(-) (cipB) [Streptococcus pneumoniae strain 15H4024]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=819244 R4711_RS02905 WP_001813641.1 580198..580347(-) (cipB) [Streptococcus pneumoniae strain 15H4024]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49