Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4703_RS08660 Genome accession   NZ_CP137100
Coordinates   1597024..1597173 (+) Length   49 a.a.
NCBI ID   WP_001820573.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain LYP     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1592024..1602173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4703_RS08610 comA/nlmT 1592064..1592651 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4703_RS08615 blpI 1592933..1593130 (+) 198 WP_001093261.1 bacteriocin-like peptide BlpI -
  R4703_RS08620 blpJ 1593597..1593866 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  R4703_RS08625 blpU 1593935..1594165 (+) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  R4703_RS08630 - 1594168..1594287 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  R4703_RS08635 - 1594584..1594748 (+) 165 WP_000727118.1 hypothetical protein -
  R4703_RS08640 - 1594745..1595149 (+) 405 WP_000846944.1 hypothetical protein -
  R4703_RS08645 - 1595352..1596157 (+) 806 Protein_1660 IS5 family transposase -
  R4703_RS08650 blpM 1596307..1596561 (+) 255 WP_000379877.1 two-peptide bacteriocin subunit BlpM -
  R4703_RS08655 blpN 1596577..1596780 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R4703_RS08660 cipB 1597024..1597173 (+) 150 WP_001820573.1 bacteriocin-like peptide BlpO Regulator
  R4703_RS08665 - 1597277..1597396 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4703_RS08670 - 1598182..1598565 (+) 384 WP_219576289.1 immunity protein -
  R4703_RS08675 - 1598617..1599306 (+) 690 WP_000760510.1 CPBP family intramembrane glutamic endopeptidase -
  R4703_RS08680 blpZ 1599348..1599581 (+) 234 WP_001818347.1 immunity protein BlpZ -
  R4703_RS08685 - 1599732..1600343 (+) 612 WP_050259050.1 CPBP family intramembrane glutamic endopeptidase -
  R4703_RS08690 ccrZ 1600504..1601298 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  R4703_RS08695 trmB 1601295..1601930 (+) 636 WP_001266083.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.91 Da        Isoelectric Point: 3.9133

>NTDB_id=818485 R4703_RS08660 WP_001820573.1 1597024..1597173(+) (cipB) [Streptococcus pneumoniae strain LYP]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=818485 R4703_RS08660 WP_001820573.1 1597024..1597173(+) (cipB) [Streptococcus pneumoniae strain LYP]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51